PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g60020.1
Common NameB1148D12.1, LOC4327485, NAC4, NAC68, Os01g0816100, OSJNBa0085D07.44
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 319aa    MW: 35347 Da    PI: 8.4406
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g60020.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.42.8e-53211481128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeelvv+yL++kv++++l++  +i+evd+yk++PwdLp+k+  ++kewyfF++rd+ky++g+r+nra+ +gyWkatg dk+v 
  LOC_Os01g60020.1  21 LPPGFRFHPTDEELVVHYLCRKVARQPLPV-PIIAEVDLYKLDPWDLPEKALFGRKEWYFFTPRDRKYPNGSRPNRAAGRGYWKATGADKPVA 112
                       79****************************.88***************8877899************************************** PP

               NAM  94 sk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                        k + ++vg+kk Lvfy+g+ap+g+ktdW+mheyrl
  LOC_Os01g60020.1 113 PKgSARTVGIKKALVFYSGKAPRGVKTDWIMHEYRL 148
                       9866778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-6417175IPR003441NAC domain
PROSITE profilePS5100561.94321175IPR003441NAC domain
PfamPF023659.8E-2822148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009071anatomyanther wall tapetum
PO:0001029developmental stageE tetrad stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MEMAAAVGGS GRRDAEAELN LPPGFRFHPT DEELVVHYLC RKVARQPLPV PIIAEVDLYK  60
LDPWDLPEKA LFGRKEWYFF TPRDRKYPNG SRPNRAAGRG YWKATGADKP VAPKGSARTV  120
GIKKALVFYS GKAPRGVKTD WIMHEYRLAD ADRAPGGKKG SQKLDEWVLC RLYNKKNNWE  180
KVKLEQQDVA SVAAAAPRNH HHQNGEVMDA AAADTMSDSF QTHDSDIDNA SAGLRHGGCG  240
GGGFGDVAPP RNGFVTVKED NDWFTGLNFD ELQPPYMMNL QHMQMQMVNP AAPGHDGGYL  300
QSISSPQMKM WQTILPPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-9571811174Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.43840.0callus| flower| leaf| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO625309080.0
Expression AtlasQ52QH4-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in stems, leaf blades and callus. Weakly expressed in developing flowers. {ECO:0000269|PubMed:10660065}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g60020.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g60020
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0281830.0AB028183.1 Oryza sativa mRNA for OsNAC4 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623706.10.0PREDICTED: NAC domain-containing protein 68
SwissprotQ52QH40.0NAC68_ORYSJ; NAC domain-containing protein 68
TrEMBLI1NSP40.0I1NSP4_ORYGL; Uncharacterized protein
STRINGLOC_Os01g60020.10.0(Oryza sativa Japonica Group)
STRINGORGLA01G0288400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP53893761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-86NAC family protein
Publications ? help Back to Top
  1. Kikuchi K, et al.
    Molecular analysis of the NAC gene family in rice.
    Mol. Gen. Genet., 2000. 262(6): p. 1047-51
    [PMID:10660065]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]