PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g59760.1
Common NameLOC4327590, OsJ_03842
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 336aa    MW: 36049.5 Da    PI: 10.1122
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g59760.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.83.7e-16265315556
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                       +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN +Lk + +el +++
  LOC_Os01g59760.1 265 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENVRLK-RQKELDELI 315
                       79***************************************9.666666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.2E-14260308No hitNo description
SMARTSM003388.0E-11261333IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.392263308IPR004827Basic-leucine zipper domain
CDDcd147073.39E-25265319No hitNo description
SuperFamilySSF579593.81E-11265310No hitNo description
PfamPF001706.2E-13265308IPR004827Basic-leucine zipper domain
PROSITE patternPS000360268283IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MASKAGGGGV ARRGGGRMRS LGRQGSMYSL TLDEVQSQLG EPLHSMNLDE LLRSVFPDGL  60
AIADGAGATT SSQQHQPGSG LLRQGSITMP PELSKKTVDE VWKGIQAAPK RNAETGGGGG  120
GGRRRRERQP TLGEVTLEDF LVKAGVVTQG SLKELSDVGN VDPVGRGVTA TGTVDLAPGS  180
HWIEQYKQQI ASTDAHHHGQ QGVQGAYFPN RLVPQPLNVG PGAILEPSYS DGQTSSGMIG  240
GMSDSQTPGR KRGMSGDVAD KLMERRQKRM IKNRESAARS RARKQAYTNE LENKVSRLEE  300
ENVRLKRQKE LDELICAVPV PEPKYQLRRT SSADF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1121128GRRRRERQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.422000.0panicle| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasB9ETU8
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g59760.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g59760
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0043310.0AP004331.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OSJNBa0085D07.
GenBankAP0035700.0AP003570.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0432B10.
GenBankAP0032470.0AP003247.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0425G02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627754.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES33e-83AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLB9ETU80.0B9ETU8_ORYSJ; Uncharacterized protein
STRINGLOC_Os01g59760.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5401580
MonocotsOGMP27073883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.11e-75ABA-responsive element binding protein 3