PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g59660.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 475aa    MW: 51606.6 Da    PI: 5.4303
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g59660.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.89.3e-174289148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT  Ed +lvd+vk++G g+W+++ +  g+ R++k+c++rw ++l
  LOC_Os01g59660.3 42 KGPWTSAEDAILVDYVKKHGEGNWNAVQKNTGLFRCGKSCRLRWANHL 89
                      79******************************************9986 PP

2Myb_DNA-binding51.22.8e-1695138146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +g++T+eE+ l+++++ ++G++ W++ a++++ gRt++++k++w++
  LOC_Os01g59660.3  95 KGAFTAEEERLIIQLHSKMGNK-WARMAAHLP-GRTDNEIKNYWNT 138
                       799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.6253789IPR017930Myb domain
SuperFamilySSF466895.99E-3139136IPR009057Homeodomain-like
SMARTSM007172.1E-144191IPR001005SANT/Myb domain
PfamPF002499.0E-154289IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-234396IPR009057Homeodomain-like
CDDcd001672.00E-114489No hitNo description
PROSITE profilePS5129425.02690144IPR017930Myb domain
SMARTSM007176.3E-1794142IPR001005SANT/Myb domain
PfamPF002493.1E-1595138IPR001005SANT/Myb domain
CDDcd001671.61E-1297138No hitNo description
Gene3DG3DSA:1.10.10.601.4E-2597142IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0009908Biological Processflower development
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MYRVKSESDC DMIHQEQMDS PVADDGSSGG SPHRGGGPPL KKGPWTSAED AILVDYVKKH  60
GEGNWNAVQK NTGLFRCGKS CRLRWANHLR PNLKKGAFTA EEERLIIQLH SKMGNKWARM  120
AAHLPGRTDN EIKNYWNTRI KRCQRAGLPI YPTSVCNQSS NEDQQCSSDF DCGENLSNDL  180
LNANGLYLPD FTCDNFIANS EALPYAPHLS AVSISNLLGQ SFASKSCSFM DQVNQTGMLK  240
QSDGVLPGLS DTINGVISSV DQFSNDSEKL KQAVGFDYLH EANSTSKIIA PFGGALNGSH  300
AFLNGNFSAS RPTSGPLKME LPSLQDTESD PNSWLKYTVA PALQPTELVD PYLQSPAATP  360
SVKSECASPR NSGLLEELIH EAQTLRSGKN QQTSVISSSS SVGTPCNTTV LSPEFDMCQE  420
YWEEQHPGPF LNDCAPFSGN SFTESTPPVS AASPDIFQLS KVSPGWTLKF LIPL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-33361421106B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.26980.0callus| flower| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329739690.0
Expression AtlasB7E984-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g59660.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g59660
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0639510.0AK063951.1 Oryza sativa Japonica Group cDNA clone:001-123-F05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622335.10.0PREDICTED: transcription factor GAMYB
RefseqXP_015622336.10.0PREDICTED: transcription factor GAMYB
SwissprotQ0JIC20.0GAM1_ORYSJ; Transcription factor GAMYB
TrEMBLB7E9840.0B7E984_ORYSJ; cDNA clone:001-123-F05, full insert sequence
STRINGLOC_Os01g59660.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.18e-85myb domain protein 33