PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g58760.1
Common NameOsJ_03780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 164aa    MW: 18257.8 Da    PI: 7.4573
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g58760.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.25.6e-11958150
                      XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1  1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50
                      e+el+++r+   NReA r++R++Kka  + Lee+vk+L + N++L  +l+
  LOC_Os01g58760.1  9 EEELRKTRKPLGNREAVRKYREKKKAHAAFLEEEVKKLRTTNQQLLRRLQ 58
                      789******************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.8E-12976IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.8E-15977No hitNo description
PROSITE profilePS502178.9791158IPR004827Basic-leucine zipper domain
PfamPF077163.7E-121158IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.23E-91259No hitNo description
CDDcd146864.28E-101467No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MASGENNVEE ELRKTRKPLG NREAVRKYRE KKKAHAAFLE EEVKKLRTTN QQLLRRLQGH  60
ISLEAEVVRL RALLFDIRGK IDAEIGTFPF QKQCSFGSVT CTDHSPCFNT STEVAVREES  120
SRPTIVDCGI DGTGIISHEL DIPKMVNSVD VIPSFVNSAS LTE*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.148259e-61stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasA2ZYR0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g58760.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g58760
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0032210.0AP003221.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0003D09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618027.11e-117PREDICTED: uncharacterized protein LOC107278258
RefseqXP_015618034.11e-117PREDICTED: uncharacterized protein LOC107278258
TrEMBLA0A0D3EV531e-118A0A0D3EV53_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0N3R41e-118A0A0E0N3R4_ORYRU; Uncharacterized protein
TrEMBLA2ZYR01e-118A2ZYR0_ORYSJ; Uncharacterized protein
TrEMBLI1NSG71e-118I1NSG7_ORYGL; Uncharacterized protein
STRINGLOC_Os01g58760.11e-117(Oryza sativa Japonica Group)
STRINGORGLA01G0280700.11e-117(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19701536
MonocotsOGMP38313675
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.15e-26bZIP family protein