PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g57890.2
Common NameLOC4325864, Os01g0788800, P0415A04.46-1, P0415A04.46-2, P0415A04.46-3, P0415A04.46-4, P0557A01.4-1, P0557A01.4-2, P0557A01.4-3, P0557A01.4-4, TF1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 630aa    MW: 69493.7 Da    PI: 7.9616
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g57890.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.82.4e-101421556
                      HHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox 15 LeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      ++++F  + +p+  ++++L++ +gL  +qVk+WFqN+R++ k
  LOC_Os01g57890.2  1 MNRFFSICGHPDDGQKRHLSETTGLGLDQVKFWFQNKRTQVK 42
                      6789999*******************************9877 PP

2START89.28.6e-291423572205
                       HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S...EEEEE CS
             START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla...kaetl 82 
                       la  a+ +l+ +a++  ++W+ ++    e +n++ + q  + +++     +++ea ra+ +v m+   +v  l+d    + + ++   + +++
  LOC_Os01g57890.2 142 LAKNAMHALIILAESHVALWFPVPgcsyEVLNKMAYDQAYPGDNSanaigFKTEATRAVSMVMMDYKSVVDFLMDPY-NYRTFFPeviSGAVT 233
                       6788999999**************999988888888888866666888999****************6665555555.555555544499999 PP

                       EEECTT.......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
             START  83 evissg.......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwv 167
                       ++i +        g++qlm+ e++++splvp R+ +f+Ry+  l++g  v+ dvS+d  +  +      ++++ pSg+li++   + +kvt +
  LOC_Os01g57890.2 234 NRIYTWptsdgynGVIQLMTVEMMFPSPLVPaRKCTFLRYCNVLNEGLVVVIDVSLDDGSIFS------KCRKMPSGFLIQSIRPNSCKVTAI 320
                       99977777789*********************************************9988866......7*********************** PP

                       E-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
             START 168 ehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                       ehv  ++  +h+l+++ ++ gl++ga++wvat+ rq +
  LOC_Os01g57890.2 321 EHVLADDTGVHELYQPCMN-GLVFGARRWVATMARQSA 357
                       ****************985.89***********99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007112.034144IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.0E-9142IPR009057Homeodomain-like
PfamPF000468.2E-8142IPR001356Homeobox domain
CDDcd000862.51E-8144No hitNo description
SuperFamilySSF466891.97E-10248IPR009057Homeodomain-like
PROSITE patternPS0002701942IPR017970Homeobox, conserved site
PROSITE profilePS5084818.551132361IPR002913START domain
CDDcd088752.80E-94136357No hitNo description
SMARTSM002341.7E-7141358IPR002913START domain
PfamPF018529.6E-22142357IPR002913START domain
SuperFamilySSF559611.96E-20191356No hitNo description
SuperFamilySSF559611.02E-8375583No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009072anatomyplant ovary
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 630 aa     Download sequence    Send to blast
MNRFFSICGH PDDGQKRHLS ETTGLGLDQV KFWFQNKRTQ VKTMCWKEEN YKLSVENEIL  60
RDENRRVKIA HCTAVCLTCC NSSVQNQLAV EMERLMGQSE WLQQEIARSN GTPPAANLAF  120
QLNSSADYVF SGQHDQQMIA ELAKNAMHAL IILAESHVAL WFPVPGCSYE VLNKMAYDQA  180
YPGDNSANAI GFKTEATRAV SMVMMDYKSV VDFLMDPYNY RTFFPEVISG AVTNRIYTWP  240
TSDGYNGVIQ LMTVEMMFPS PLVPARKCTF LRYCNVLNEG LVVVIDVSLD DGSIFSKCRK  300
MPSGFLIQSI RPNSCKVTAI EHVLADDTGV HELYQPCMNG LVFGARRWVA TMARQSARMR  360
DVHHNKTAPQ VSTKGRKNLM KLADDLLASF AGGIAATGGG TWTVVIGAGT EKDIRVAYRR  420
TTEGSSSYNA ILSVTASLRL PLPMRKTFDL LRNLTHRCKW DVLVHGSVVK EEVTIARGVG  480
NDDTVTVLHC KRAGREDRGR TMILQNNGYD ASGSFMVYSQ IDSELMNTMV LSPSDLPPGR  540
GGPSLYPTGF SLLPDVEAAQ DSSGIALGEV GGTLMTMGFQ IPVKLASGDR MYSRSAASAI  600
RLMTDTIALV KKTLMNEHSG IYGVSPFHP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.183900.0flower| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO220231560.0
Expression AtlasQ5ZAY0-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the embryo proper and both layers of the integument at 2 days after pollination (DAP). At 3 DAP, strongly expressed in the outer cell layer of the embryo and at lower levels in the integument and the outer endosperm layer (prealeurone layer). From 4 DAP to 6 DAP, expressed in the integument, the scutellar epithelium and embryo axis. Expression stongly decreases from 8 DAP to disappear completely at 10 DAP. Expressed in young seedlings developing roots at the root hair-forming side of epidermal cells. {ECO:0000269|PubMed:12091716}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g57890.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g57890
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1213380.0AK121338.1 Oryza sativa Japonica Group cDNA clone:J023120G04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632244.10.0PREDICTED: homeobox-leucine zipper protein TF1
SwissprotQ5ZAY00.0TF1_ORYSJ; Homeobox-leucine zipper protein TF1
TrEMBLA0A0E0N3H10.0A0A0E0N3H1_ORYRU; Uncharacterized protein
STRINGLOC_Os01g57890.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.21e-100HD-ZIP family protein
Publications ? help Back to Top
  1. Yang JY,Chung MC,Tu CY,Leu WM
    OSTF1: a HD-GL2 family homeobox gene is developmentally regulated during early embryogenesis in rice.
    Plant Cell Physiol., 2002. 43(6): p. 628-38
    [PMID:12091716]