PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g57890.1
Common NameLOC4325864, Os01g0788800, P0415A04.46-1, P0415A04.46-2, P0415A04.46-3, P0415A04.46-4, P0557A01.4-1, P0557A01.4-2, P0557A01.4-3, P0557A01.4-4, TF1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 710aa    MW: 78179.3 Da    PI: 7.3484
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g57890.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox42.31.3e-1368122256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       r+ +++t +q e+Le +F  + +p+  ++++L++ +gL  +qVk+WFqN+R++ k
  LOC_Os01g57890.1  68 RRLQRLTGKQSEVLEGFFSICGHPDDGQKRHLSETTGLGLDQVKFWFQNKRTQVK 122
                       445789*********************************************9877 PP

2START88.91.1e-282224372205
                       HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S...EEEEE CS
             START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla...kaetl 82 
                       la  a+ +l+ +a++  ++W+ ++    e +n++ + q  + +++     +++ea ra+ +v m+   +v  l+d    + + ++   + +++
  LOC_Os01g57890.1 222 LAKNAMHALIILAESHVALWFPVPgcsyEVLNKMAYDQAYPGDNSanaigFKTEATRAVSMVMMDYKSVVDFLMDPY-NYRTFFPeviSGAVT 313
                       6788999999**************999988888888888866666888999****************6665555555.555555544499999 PP

                       EEECTT.......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
             START  83 evissg.......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwv 167
                       ++i +        g++qlm+ e++++splvp R+ +f+Ry+  l++g  v+ dvS+d  +  +      ++++ pSg+li++   + +kvt +
  LOC_Os01g57890.1 314 NRIYTWptsdgynGVIQLMTVEMMFPSPLVPaRKCTFLRYCNVLNEGLVVVIDVSLDDGSIFS------KCRKMPSGFLIQSIRPNSCKVTAI 400
                       99977777789*********************************************9988866......7*********************** PP

                       E-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
             START 168 ehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                       ehv  ++  +h+l+++ ++ gl++ga++wvat+ rq +
  LOC_Os01g57890.1 401 EHVLADDTGVHELYQPCMN-GLVFGARRWVATMARQSA 437
                       ****************985.89***********99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.8E-1559126IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-1459118IPR009057Homeodomain-like
PROSITE profilePS5007114.26864124IPR001356Homeobox domain
CDDcd000861.53E-1265124No hitNo description
SMARTSM003893.5E-1066128IPR001356Homeobox domain
PfamPF000463.4E-1168122IPR001356Homeobox domain
PROSITE patternPS00027099122IPR017970Homeobox, conserved site
PROSITE profilePS5084818.551212441IPR002913START domain
CDDcd088756.58E-94216437No hitNo description
SMARTSM002341.7E-7221438IPR002913START domain
PfamPF018521.2E-21222437IPR002913START domain
SuperFamilySSF559612.93E-20271436No hitNo description
SuperFamilySSF559611.47E-8455663No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009072anatomyplant ovary
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 710 aa     Download sequence    Send to blast
MEMNQQHNEG NESFVALMNG FAGDGTATLP NDGEQRMSIP ARELFAAIEA DSGLLPVNSS  60
NTNEKRKRRL QRLTGKQSEV LEGFFSICGH PDDGQKRHLS ETTGLGLDQV KFWFQNKRTQ  120
VKTMCWKEEN YKLSVENEIL RDENRRVKIA HCTAVCLTCC NSSVQNQLAV EMERLMGQSE  180
WLQQEIARSN GTPPAANLAF QLNSSADYVF SGQHDQQMIA ELAKNAMHAL IILAESHVAL  240
WFPVPGCSYE VLNKMAYDQA YPGDNSANAI GFKTEATRAV SMVMMDYKSV VDFLMDPYNY  300
RTFFPEVISG AVTNRIYTWP TSDGYNGVIQ LMTVEMMFPS PLVPARKCTF LRYCNVLNEG  360
LVVVIDVSLD DGSIFSKCRK MPSGFLIQSI RPNSCKVTAI EHVLADDTGV HELYQPCMNG  420
LVFGARRWVA TMARQSARMR DVHHNKTAPQ VSTKGRKNLM KLADDLLASF AGGIAATGGG  480
TWTVVIGAGT EKDIRVAYRR TTEGSSSYNA ILSVTASLRL PLPMRKTFDL LRNLTHRCKW  540
DVLVHGSVVK EEVTIARGVG NDDTVTVLHC KRAGREDRGR TMILQNNGYD ASGSFMVYSQ  600
IDSELMNTMV LSPSDLPPGR GGPSLYPTGF SLLPDVEAAQ DSSGIALGEV GGTLMTMGFQ  660
IPVKLASGDR MYSRSAASAI RLMTDTIALV KKTLMNEHSG IYGVSPFHP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.183900.0flower| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO220231560.0
Expression AtlasQ5ZAY0-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the embryo proper and both layers of the integument at 2 days after pollination (DAP). At 3 DAP, strongly expressed in the outer cell layer of the embryo and at lower levels in the integument and the outer endosperm layer (prealeurone layer). From 4 DAP to 6 DAP, expressed in the integument, the scutellar epithelium and embryo axis. Expression stongly decreases from 8 DAP to disappear completely at 10 DAP. Expressed in young seedlings developing roots at the root hair-forming side of epidermal cells. {ECO:0000269|PubMed:12091716}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g57890.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g57890
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3178820.0AF317882.1 Oryza sativa transcription factor 1 (TF1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632244.10.0PREDICTED: homeobox-leucine zipper protein TF1
SwissprotQ5ZAY00.0TF1_ORYSJ; Homeobox-leucine zipper protein TF1
TrEMBLA0A0E0N3H10.0A0A0E0N3H1_ORYRU; Uncharacterized protein
STRINGLOC_Os01g57890.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1438133
MonocotsOGMP104752833
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.21e-104HD-ZIP family protein
Publications ? help Back to Top
  1. Yang JY,Chung MC,Tu CY,Leu WM
    OSTF1: a HD-GL2 family homeobox gene is developmentally regulated during early embryogenesis in rice.
    Plant Cell Physiol., 2002. 43(6): p. 628-38
    [PMID:12091716]