PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g55580.1
Common NameLOC4327019, Os01g0761100, OSNPB_010761100, P0512C01.15
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family CPP
Protein Properties Length: 620aa    MW: 66772.9 Da    PI: 8.9816
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g55580.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR40.94.1e-13158196241
               TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                       +kk CnCk+skClk+YCeCfa+g++C+  C+C++C+N+ +
  LOC_Os01g55580.1 158 KKKCCNCKHSKCLKLYCECFASGVYCDG-CNCSNCFNNVK 196
                       799*************************.********987 PP

2TCR50.83.3e-16242281140
               TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                       k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  LOC_Os01g55580.1 242 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 281
                       589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.8E-14157197IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.003158282IPR005172CRC domain
PfamPF036381.7E-9159194IPR005172CRC domain
SMARTSM011148.4E-20242283IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-12245280IPR005172CRC domain
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 620 aa     Download sequence    Send to blast
MAGKEQQGGG GPPPPPRAPV PAASSQPPIK KLVRQLDFTS AALAGNPAMA AAAAAVSRAL  60
QPRAVPVGFP QPQQLRAHLP VGVPQQLHPR GLPVMRSHHV VHVPLPRPAV AVAVPVPQVR  120
PAQPQPVPRP PVAVPLKPES PKPPRARLYE GKDGTPTKKK CCNCKHSKCL KLYCECFASG  180
VYCDGCNCSN CFNNVKNETA RREAIDATLE RNPDAFRPKI GSSPHANRNN MEAAGDLPLV  240
GKHNKGCHCK KSGCLKKYCE CFQANILCSE NCKCMDCKNF EGSEERKALF QGDHKNSIHM  300
QQAANAAVNG AIGAAAFSSP SASRKRKHID PSLDHSAKEN GAHRTNHVPQ KNGMPSDGPL  360
PINQPVHPPT LGPFKVTYRP LLADIVQPGD VKELCKLLVV VSGNAAKAYA GKKSQDKVVE  420
KEDEMGGKRE GEIGGSLAST NHDREENNND PNNQKASADD PSTGGTRAGK ASLEESKHDC  480
NDDQKSNRPM SPGTLALMCD EQDTMFMTSQ NVVPQQPAPV NQNQSELYAE QERCVLTEFR  540
DCLHKLVTFG RMKEEKFSMA IKSEVPAHPM QANGVSRIPY SKEVDVPVVK TFLQSSSRHP  600
AAGNSATGHL DKKPKHENT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.265830.0callus| leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379917580.0
Expression AtlasQ5JMF9-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g55580.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g55580
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1221120.0AK122112.1 Oryza sativa Japonica Group cDNA clone:J033127O09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621699.10.0PREDICTED: protein tesmin/TSO1-like CXC 5 isoform X1
TrEMBLQ5JMF90.0Q5JMF9_ORYSJ; Os01g0761100 protein
STRINGLOC_Os01g55580.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14691745
MonocotsOGMP47303657
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-122Tesmin/TSO1-like CXC domain-containing protein