PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g55549.1
Common NameGL2-9, Os01g0760800, P0460E08.22, P0512C01.11, ROC9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 817aa    MW: 88638.8 Da    PI: 6.8357
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g55549.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox642.1e-2096151156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       r++ +++t+eq++++e+lF+++++p++++r++ +k+lgL+ rqVk+WFqNrR++ k
  LOC_Os01g55549.1  96 RKNYHRHTAEQIRIMEALFKESPHPDERQRQQVSKQLGLSARQVKFWFQNRRTQIK 151
                       788999**********************************************9877 PP

2START173.51.3e-543125382206
                       HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
             START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv........dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                       la +a++elv + +++ep+Wv+ +    +++n+de+++ f ++++         ++ea+r++g+v  +++ lv +++d+  +W+  ++    k
  LOC_Os01g55549.1 312 LATRALDELVGMCSSGEPVWVRGVetgrDILNYDEYVRLFRRDHGgsgdqmagWTVEASRECGLVYLDTMHLVHTFMDVD-KWKDLFPtmisK 403
                       78899*************************************999***********************************.99998888888* PP

                       EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEE CS
             START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskv 164
                       a+tle is+       g+lqlm+aelq l+p+vp R+ +f+Ry+++l a++w+ivdvS d+ +     ss vR+ + pSg+lie+  ng++k+
  LOC_Os01g55549.1 404 AATLEMISNReddgrdGVLQLMYAELQTLTPMVPtRELYFARYCKKLAAERWAIVDVSFDESETGVHASSAVRCWKNPSGCLIEEQNNGRCKM 496
                       ********99999***********************************************9999998************************** PP

                       EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       twveh+ ++  ++  l+r +  sg+a+ga++wva+lq qce+
  LOC_Os01g55549.1 497 TWVEHTRCRRCTVAPLYRAVTASGVAFGARRWVAALQLQCER 538
                       ****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.43E-2079154IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.0E-2282147IPR009057Homeodomain-like
CDDcd000865.50E-1793151No hitNo description
PROSITE profilePS5007117.62193153IPR001356Homeobox domain
SMARTSM003893.5E-1795157IPR001356Homeobox domain
PfamPF000468.6E-1896151IPR001356Homeobox domain
PROSITE patternPS000270128151IPR017970Homeobox, conserved site
PROSITE profilePS5084839.795302541IPR002913START domain
SuperFamilySSF559612.33E-31303538No hitNo description
CDDcd088755.34E-111306537No hitNo description
SMARTSM002343.7E-46311538IPR002913START domain
PfamPF018523.7E-45312538IPR002913START domain
Gene3DG3DSA:3.30.530.207.1E-4379502IPR023393START-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010062Biological Processnegative regulation of trichoblast fate specification
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009072anatomyplant ovary
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 817 aa     Download sequence    Send to blast
MGTNRPRPRT KDFFAAPALS LTLAGVFGRK NGPAASGGDG VEEGDEEVQA AGEAAVEISS  60
ENAGPGCRQS QSGGGSGEDG GHDDDDGEGS NKKRRRKNYH RHTAEQIRIM EALFKESPHP  120
DERQRQQVSK QLGLSARQVK FWFQNRRTQI KAVQERHENS LLKSELEKLQ DEHRAMRELA  180
KKPSRCLNCG VVATSSDAAA AATAADTREQ RLRLEKAKLK AEVCMPPPRS RARPFRCATL  240
QDTDSGELAM LNLFQIERLR GTPGKSAADG IASPPCSASA GAMQTNSRSP PLHDHDGGFL  300
RHDDDKPRIL ELATRALDEL VGMCSSGEPV WVRGVETGRD ILNYDEYVRL FRRDHGGSGD  360
QMAGWTVEAS RECGLVYLDT MHLVHTFMDV DKWKDLFPTM ISKAATLEMI SNREDDGRDG  420
VLQLMYAELQ TLTPMVPTRE LYFARYCKKL AAERWAIVDV SFDESETGVH ASSAVRCWKN  480
PSGCLIEEQN NGRCKMTWVE HTRCRRCTVA PLYRAVTASG VAFGARRWVA ALQLQCERMV  540
FAVATNVPTR DSTGVSTLAG RRSVLKLAHR MTSSLCRTTG GSCDMAWRRA PKGGSGGGGD  600
DDIWLTSREN AGDDPGEPQG LIACAAASTW LPVNPTALLD LLRDESRRPE WDVMLPGKSV  660
QSRVNLAKGK DRTNCVTAYA ARPEEEEERG GKWVLQDVCT NPCESTIAYA AIDAAALQPV  720
IAGHDSSGVH LLPCGFISVM PDGLESKPAV ITASRRGGEA SGAGSLVTVA FQVPASPSAA  780
AATLSPDSVE AVTVLVSSTL RNIRKALGCD SCEEEF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19097NKKRRRKN
29196KKRRRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.753530.0panicle
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ5JMF3
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g55549.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g55549
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0032740.0AP003274.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0512C01.
GenBankAP0032560.0AP003256.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0460E08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644459.10.0PREDICTED: homeobox-leucine zipper protein ROC9
SwissprotQ5JMF30.0ROC9_ORYSJ; Homeobox-leucine zipper protein ROC9
TrEMBLA0A0E0FTG00.0A0A0E0FTG0_ORYNI; Uncharacterized protein
STRINGLOC_Os01g55549.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9080913
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.10.0HD-ZIP family protein