PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g55340.1
Common NameB1131G08.10, LOC4325308, Os01g0758200, OSNPB_010758200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 212aa    MW: 23094.8 Da    PI: 9.0833
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g55340.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.65.7e-38107162459
            zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                       + l+cprC s++tkfCy+nny+++qPr+fCkaC+ryWt+GGalrnvPvG+grrkn+
  LOC_Os01g55340.1 107 APLPCPRCRSRDTKFCYFNNYNVNQPRHFCKACHRYWTAGGALRNVPVGAGRRKNR 162
                       5689**************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088428.751109163IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-26109162IPR003851Zinc finger, Dof-type
PfamPF027014.3E-31109162IPR003851Zinc finger, Dof-type
PROSITE patternPS013610111147IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MLSHVEMAPA AGGFKLFGKV IMQCGVSEGT QDKAQGFVVA REKVEPEEEE EEEQRVPAAA  60
TSGQRASIKR EAADRDEEQR QGGGDAAGQP TQRRLQDSAE ARAAAAAPLP CPRCRSRDTK  120
FCYFNNYNVN QPRHFCKACH RYWTAGGALR NVPVGAGRRK NRPLGPLAVA HHNHHHRAAA  180
GFVLGFPNPS SPTSPSPVYT DRWPVTPDRP F*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.1008180.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329811060.0
Expression AtlasQ5JLR7-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g55340.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g55340
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0034090.0AP003409.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1131G08.
GenBankAK0710830.0AK071083.1 Oryza sativa Japonica Group cDNA clone:J023076F14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630447.11e-156PREDICTED: cyclic dof factor 2
TrEMBLQ5JLR71e-156Q5JLR7_ORYSJ; C2C2-Dof transcription factor
STRINGLOC_Os01g55340.11e-156(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MonocotsOGMP64952851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.13e-33Dof family protein