PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g55150.1
Common NameBZIP06, LOC4325139, Os01g0756200, OsJ_03500, P0503C12.45
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 266aa    MW: 28400.4 Da    PI: 6.7482
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g55150.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.31.2e-11138186452
                       XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                        kr +r   NR +A+rsR RK+++i eLe+ v +L++e + L  ++  l
  LOC_Os01g55150.1 138 PKRVKRILANRQSAQRSRVRKLQYISELERSVTTLQNEVSVLSPRVAFL 186
                       5999**********************************88887666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.2E-14135199IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.795137189IPR004827Basic-leucine zipper domain
PfamPF001709.6E-10139184IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.9E-12139193No hitNo description
SuperFamilySSF579596.54E-12139193No hitNo description
CDDcd147033.10E-23140191No hitNo description
PROSITE patternPS000360142157IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MAQLPPKIPV AAPGHHQHWA SAGGAGDAAW ADEFAEFAAS RRGAHRRSLS DSVAFVEVAP  60
AGCGAGGEFD RLDDDQLMSM FPDEGGSSAP GSDNGGSDSD GGGDKHAAAQ SDDGQHAAGE  120
PTQEQAAATS PTELIRDPKR VKRILANRQS AQRSRVRKLQ YISELERSVT TLQNEVSVLS  180
PRVAFLDQQR TILTVGNSHL KQRIAALAQD KIFKDAHQEA LRKEIERLRQ VYQQQNTKLS  240
GGLAADHAHV HGGPPPVRAE KELMS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.556840.0leaf| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329937620.0
Expression AtlasQ5JMK6-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, shoots and panicles. {ECO:0000269|PubMed:18065552}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g55150.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g55150
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1085530.0AK108553.1 Oryza sativa Japonica Group cDNA clone:002-144-E08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634100.10.0PREDICTED: basic leucine zipper 6
SwissprotQ5JMK60.0BZP06_ORYSJ; Basic leucine zipper 6
TrEMBLA0A0D9YF450.0A0A0D9YF45_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0C7W20.0A0A0E0C7W2_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0N2L40.0A0A0E0N2L4_ORYRU; Uncharacterized protein
TrEMBLB8A9R70.0B8A9R7_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA004481-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os01g55150.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12617181
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.14e-56bZIP family protein
Publications ? help Back to Top
  1. Nijhawan A,Jain M,Tyagi AK,Khurana JP
    Genomic survey and gene expression analysis of the basic leucine zipper transcription factor family in rice.
    Plant Physiol., 2008. 146(2): p. 333-50
    [PMID:18065552]