PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g54930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family VOZ
Protein Properties Length: 430aa    MW: 48111.8 Da    PI: 4.8801
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g54930.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ4311.7e-1321303471217
               VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwna 92 
                       p p+afl+pkcalwdc+rpaqgse++qdycs++ha+la++e g+pgt+pv+rp+gidlkdg+lfaalsak+qgk+vgip+cegaatakspwna
  LOC_Os01g54930.1 130 PVPAAFLRPKCALWDCPRPAQGSERWQDYCSMYHADLAVKEeGPPGTMPVIRPRGIDLKDGPLFAALSAKIQGKHVGIPVCEGAATAKSPWNA 222
                       89*************************************9879************************************************** PP

               VOZ  93 aelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrl 185
                       +elfdl ++ege+irewlffdkprrafesgnrkqrslpdy+grgwhesrkqvmk+fgglkrsyymdpqps+s+ewhlyeyein++da+alyrl
  LOC_Os01g54930.1 223 PELFDLYIFEGESIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVMKDFGGLKRSYYMDPQPSNSYEWHLYEYEINDCDAFALYRL 315
                       ********************************************************************************************* PP

               VOZ 186 elklvdekksakgkvskdsladlqkklgrlta 217
                       e+k++d+kk+ak+k+++++l+++q++++rl+a
  LOC_Os01g54930.1 316 EFKSSDAKKTAKSKLACNPLNEIQQQMVRLSA 347
                       ******************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MKPEPPEEAV ASPADLTVPQ QPQSPGQGVL ASGGGMLAPA AAAVFHDQMY YVNQELTVED  60
FLYDDNYKMY LPGYNSDVLN NLESTGQLEY PQFNLPQELP PNAYLDTSNC GQNAGDVFLH  120
MSDLLNTMSP VPAAFLRPKC ALWDCPRPAQ GSERWQDYCS MYHADLAVKE EGPPGTMPVI  180
RPRGIDLKDG PLFAALSAKI QGKHVGIPVC EGAATAKSPW NAPELFDLYI FEGESIREWL  240
FFDKPRRAFE SGNRKQRSLP DYNGRGWHES RKQVMKDFGG LKRSYYMDPQ PSNSYEWHLY  300
EYEINDCDAF ALYRLEFKSS DAKKTAKSKL ACNPLNEIQQ QMVRLSADSP VENKRSARSR  360
TKANPNDINS NIYLVQNTTV QGSIPNAYQA VSQPDQMTYL NGNVVYGPHL PYGYSTERSD  420
FYWSSNDGA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.180720.0callus| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2975976290.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g54930.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g54930
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2417650.0AK241765.1 Oryza sativa Japonica Group cDNA, clone: J065205E23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621735.10.0PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ01e-126VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A0D3EU290.0A0A0D3EU29_9ORYZ; Uncharacterized protein
TrEMBLA0A0D9YF220.0A0A0D9YF22_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0FT900.0A0A0E0FT90_ORYNI; Uncharacterized protein
TrEMBLA0A0E0N2I80.0A0A0E0N2I8_ORYRU; Uncharacterized protein
STRINGLOC_Os01g54930.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP23271335
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-120vascular plant one zinc finger protein