PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g54210.1
Common NameLOC4326175, Os01g0745700, OSJNBa0014K08.27-1, OSNPB_010745700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GATA
Protein Properties Length: 388aa    MW: 40610.5 Da    PI: 6.6245
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g54210.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.29.3e-18264298135
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                       C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  LOC_Os01g54210.1 264 CLHCETDKTPQWRTGPMGPKTLCNACGVRYKSGRL 298
                       99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169926.7E-7115347IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011412.453258294IPR000679Zinc finger, GATA-type
SMARTSM004011.3E-18258308IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.104.4E-15258295IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577161.24E-15260321No hitNo description
CDDcd002021.58E-14263314No hitNo description
PROSITE patternPS003440264289IPR000679Zinc finger, GATA-type
PfamPF003201.4E-15264298IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MEVTAEFGGA YYGGAAGREK KALQQGCGDH FAVDDLLVLP YGEEDETTRE GEATGGKEEA  60
AGFGNASADS STITALDSCS NSFGLADGDF PGELCEPYDQ LAELEWLSNY MNEGDDAFAT  120
EDLQKLQLIS GIPSGGFSTA SVPSAQAQAA SAAASMAVQP GGFLPEAPVP AKARSKRSRA  180
APGNWSSRLL VLPPPPASPP SPASMAISPA ESGVSAHAFP IKKPSKPAKK KDAPAPPAQA  240
QLSSVPVHSG GSAPAAAAGE GRRCLHCETD KTPQWRTGPM GPKTLCNACG VRYKSGRLVP  300
EYRPAASPTF MVSKHSNSHR KVLELRRQKE MHQQTPHHHQ PQVAAAGGVG SLMHMQSSML  360
FDGVSPVVSG DDFLIHHHLR TDFRPPI*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.279110.0callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379915190.0
Expression AtlasQ8LIZ3-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00530DAPTransfer from AT5G25830Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g54210.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g54210
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1218960.0AK121896.1 Oryza sativa Japonica Group cDNA clone:J033105E11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631175.10.0PREDICTED: GATA transcription factor 12
TrEMBLQ8LIZ30.0Q8LIZ3_ORYSJ; Os01g0745700 protein
STRINGLOC_Os01g54210.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
MonocotsOGMP30253178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.16e-49GATA transcription factor 12