PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g53260.1
Common NameB1060H01.11, LOC4324161, Os01g0734000, OsJ_03362, OSJNBb0036G09.22, OSNPB_010734000, WRKY23
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 255aa    MW: 27796.2 Da    PI: 6.9031
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g53260.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.51.2e-32175233159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+v+r a+d+++v++tYeg Hnh+
  LOC_Os01g53260.1 175 LDDGYRWRKYGQKAVKNSKHPRSYYRCTHHTCNVKKQVQRLAKDTSIVVTTYEGVHNHP 233
                       59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.0E-33161233IPR003657WRKY domain
SuperFamilySSF1182909.15E-29167234IPR003657WRKY domain
PROSITE profilePS5081128.885170235IPR003657WRKY domain
SMARTSM007741.1E-38175234IPR003657WRKY domain
PfamPF031064.3E-26176233IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MENLQLQGDD HDDEALPHFP YFAVPSPPPL AVAPAASATT SDGHQHGPLE VLEQPPCSNN  60
LHPDGLVDGP QLAATTAVPM MLPAMTSLDW QSLLQTCLQV PPPVLEQQQP AAAAQADQYS  120
GENDHGDLQA AESSGAGNKE KQVMAKGGAG RPSGTKKKAS RPRFAFQTRS DNDILDDGYR  180
WRKYGQKAVK NSKHPRSYYR CTHHTCNVKK QVQRLAKDTS IVVTTYEGVH NHPCEKLMEA  240
LTPILKQLQF LSQF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-24165232774Probable WRKY transcription factor 4
2lex_A2e-24165232774Probable WRKY transcription factor 4
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329941180.0
Expression AtlasQ942D2-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00539DAPTransfer from AT5G41570Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g53260.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g53260
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY8706070.0AY870607.1 Oryza sativa (japonica cultivar-group) WRKY23 mRNA, complete cds.
GenBankAY3418450.0AY341845.1 Oryza sativa (japonica cultivar-group) WRKY4 mRNA, complete cds.
GenBankAK1089090.0AK108909.1 Oryza sativa Japonica Group cDNA clone:002-152-G06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621376.10.0PREDICTED: probable WRKY transcription factor 24
TrEMBLA0A0E0FSR70.0A0A0E0FSR7_ORYNI; Uncharacterized protein
TrEMBLB8A9210.0B8A921_ORYSI; Putative uncharacterized protein
TrEMBLQ942D20.0Q942D2_ORYSJ; Os01g0734000 protein
STRINGBGIOSGA004404-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os01g53260.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP110038133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41570.12e-57WRKY DNA-binding protein 24
Publications ? help Back to Top
  1. Zhang ZL, et al.
    A rice WRKY gene encodes a transcriptional repressor of the gibberellin signaling pathway in aleurone cells.
    Plant Physiol., 2004. 134(4): p. 1500-13
    [PMID:15047897]