PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g52680.1
Common NameLOC4324731, MADS32, Os01g0726400, P0042A10.22
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 197aa    MW: 22531.8 Da    PI: 8.2045
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g52680.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF70.41.6e-22958150
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                      krien ++rq tf kRr g++KKA EL vLCda+ ++++fs +gkly + 
  LOC_Os01g52680.1  9 KRIENPTQRQSTFYKRRDGLFKKARELAVLCDADLLLLLFSASGKLYHFL 58
                      79*********************************************996 PP

2K-box33.22.2e-1272170199
             K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                       y++++++++++   ++ + el+k+ +  + L++++R +  +d e+ ++  L+ Le++Le +++k+Rs K++ +  +i +lq+  +  qee   
  LOC_Os01g52680.1  72 YEATTHTKVWADIRQERRAELEKVGSMCDLLEKQLRFMTVDDGEEYTVPSLEALEHNLEAAMRKVRSEKDRKIGGEICYLQNIIRGRQEERYG 164
                       566778889*************************************************************************99999999999 PP

             K-box  94 Lrkkle 99 
                       L  k++
  LOC_Os01g52680.1 165 LCDKIA 170
                       988875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.777161IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-32160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.15E-27289IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-23323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-232338IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-233859IPR002100Transcription factor, MADS-box
PfamPF014862.7E-1484169IPR002487Transcription factor, K-box
PROSITE profilePS5129710.18685175IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MGRGRSEIKR IENPTQRQST FYKRRDGLFK KARELAVLCD ADLLLLLFSA SGKLYHFLSP  60
TVPSVREFVE RYEATTHTKV WADIRQERRA ELEKVGSMCD LLEKQLRFMT VDDGEEYTVP  120
SLEALEHNLE AAMRKVRSEK DRKIGGEICY LQNIIRGRQE ERYGLCDKIA HAQTLKDVEC  180
GSTSLSNGLD LKLGFN*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.280150.0panicle
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ8S151
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g52680.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g52680
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ7118500.0HQ711850.1 Oryza sativa Indica Group chimeric floral organs 1 mRNA, complete cds.
GenBankAY1776990.0AY177699.1 Oryza sativa (japonica cultivar-group) transcription factor MADS32 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642650.11e-144PREDICTED: MADS-box transcription factor 32
SwissprotQ8S1511e-146MAD32_ORYSJ; MADS-box transcription factor 32
TrEMBLA0A0D3ETJ81e-144A0A0D3ETJ8_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0FSJ11e-144A0A0E0FSJ1_ORYNI; Uncharacterized protein
TrEMBLI1NRD91e-144I1NRD9_ORYGL; Uncharacterized protein
TrEMBLA0A0D9YEF21e-144A0A0D9YEF2_9ORYZ; Uncharacterized protein
TrEMBLA2WUN41e-144A2WUN4_ORYSI; Chimeric floral organs 1
STRINGBGIOSGA000892-PA1e-144(Oryza sativa Indica Group)
STRINGLOC_Os01g52680.11e-144(Oryza sativa Japonica Group)
STRINGORGLA01G0242900.11e-144(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1435844
MonocotsOGMP119233439
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.12e-23AGAMOUS-like 8
Publications ? help Back to Top
  1. Lee S, et al.
    Systematic reverse genetic screening of T-DNA tagged genes in rice for functional genomic analyses: MADS-box genes as a test case.
    Plant Cell Physiol., 2003. 44(12): p. 1403-11
    [PMID:14701936]