PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g52410.1
Common NameLOC4324664, Os01g0722300, OSNPB_010722300, P0022F10.2, P0690B02.29
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 299aa    MW: 31761.2 Da    PI: 4.6593
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g52410.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding461.2e-141462148
                      TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                      rg+W++eEd +l   v+++G+  +W + +++ g++R++k+c++rw++yl
  LOC_Os01g52410.1 14 RGPWSEEEDAILRSFVERFGNAgNWIALPHKAGLKRCGKSCRLRWLNYL 62
                      89******************99*************************97 PP

2Myb_DNA-binding43.38.5e-1469111246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       g +T eEd l++ +  ++G++ W+ Ia++++ gRt++++k++w++
  LOC_Os01g52410.1  69 GGFTDEEDNLILSLYGEMGSK-WSVIASKLP-GRTDNDVKNYWNT 111
                       569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.258962IPR017930Myb domain
SuperFamilySSF466895.62E-2711109IPR009057Homeodomain-like
SMARTSM007176.2E-111364IPR001005SANT/Myb domain
PfamPF002499.5E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-221569IPR009057Homeodomain-like
CDDcd001671.74E-81662No hitNo description
PROSITE profilePS5129420.58963117IPR017930Myb domain
SMARTSM007173.1E-1367115IPR001005SANT/Myb domain
PfamPF002491.3E-1269111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.9E-2370116IPR009057Homeodomain-like
CDDcd001678.23E-1171113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MGRSPCCDKA SVKRGPWSEE EDAILRSFVE RFGNAGNWIA LPHKAGLKRC GKSCRLRWLN  60
YLRPAIRHGG FTDEEDNLIL SLYGEMGSKW SVIASKLPGR TDNDVKNYWN TKLKKRYLAA  120
AATEATTPPP PAAGDDDNNP TTQASSQPAP PTPPAPLVNL DAAGLDGAVG DNDELLLHKS  180
EQLYAELMGL IEQQQYSTIT AAAVDAATTT TSWSSPSTGT TSPTASSSTD GSSSSSNLPW  240
PAVDVHDSTM MPPLSESSGS SSGLFFGSHA FGSGSFQDLL GSAASFDDVM LSQEMLYY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-24141167107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.767320.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1160107350.0
Expression AtlasQ5JMA5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g52410.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g52410
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2413700.0AK241370.1 Oryza sativa Japonica Group cDNA, clone: J065154C10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633951.10.0PREDICTED: transcription repressor MYB5
TrEMBLA0A0D3ETH00.0A0A0D3ETH0_9ORYZ; Uncharacterized protein
TrEMBLA2WUL00.0A2WUL0_ORYSI; Putative uncharacterized protein
TrEMBLQ5JMA50.0Q5JMA5_ORYSJ; Blind-like
STRINGBGIOSGA004364-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os01g52410.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36890.12e-65MYB family protein