PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g51690.1
Common NameB1131B07.10, LOC4325945, Os01g0714800, OSNPB_010714800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 246aa    MW: 25832.6 Da    PI: 8.2902
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g51690.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY95.24.7e-30159217159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYG+K+vk+s++pr+YYrC+++gC+vkk+ver+++dp++v+++Yeg Hnh 
  LOC_Os01g51690.1 159 LDDGYKWRKYGKKSVKNSPNPRNYYRCSTEGCNVKKRVERDKNDPRYVVTMYEGIHNHV 217
                       59********************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.8E-31146217IPR003657WRKY domain
SuperFamilySSF1182901.44E-26152218IPR003657WRKY domain
PROSITE profilePS5081131.158154219IPR003657WRKY domain
SMARTSM007748.2E-33159218IPR003657WRKY domain
PfamPF031061.3E-23160216IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MYMAAAAAGA STPFNFCRHG SHAEYDAVFS GSWMARRPSA APHGGGASGS GSGSGYGAAS  60
YVAPTFGAAF RQQHLDLLDY LSDDQGVPAP PPAAVPSASY VTPAPAMAPA EPVVPDAVAA  120
AGGYPRSVAA AAAAVAGEGR DRTTTDKIAF RTRSDDEILD DGYKWRKYGK KSVKNSPNPR  180
NYYRCSTEGC NVKKRVERDK NDPRYVVTMY EGIHNHVCPG TVYYAAQDAA SGRFFVAGIS  240
HPDLN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-24150219877Probable WRKY transcription factor 4
2lex_A4e-24150219877Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.306340.0callus
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329937640.0
Expression AtlasQ5JLU2-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g51690.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g51690
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY8706090.0AY870609.1 Oryza sativa (japonica cultivar-group) WRKY26 mRNA, complete cds.
GenBankAK1085550.0AK108555.1 Oryza sativa Japonica Group cDNA clone:002-144-E10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635650.11e-179PREDICTED: probable WRKY transcription factor 23
TrEMBLQ5JLU21e-179Q5JLU2_ORYSJ; Os01g0714800 protein
STRINGLOC_Os01g51690.11e-179(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP44137206
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.13e-35WRKY DNA-binding protein 51