PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g51260.1
Common NameLOC4327821, Os01g0709000, OSNPB_010709000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 308aa    MW: 32778 Da    PI: 7.9926
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g51260.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.12e-181461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg W++eEde+lv+++  +G g+W++++r  g+ R++k+c++rw +yl
  LOC_Os01g51260.1 14 RGLWSPEEDEKLVKYISTHGHGCWSSVPRLAGLQRCGKSCRLRWINYL 61
                      788*******************************************97 PP

2Myb_DNA-binding51.81.9e-1667110146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+++++E+ l++++++ lG++ W+ Ia++++ gRt++++k++w++
  LOC_Os01g51260.1  67 RGSFSQQEESLIIELHRVLGNR-WAQIAKHLP-GRTDNEVKNFWNS 110
                       899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-26664IPR009057Homeodomain-like
PROSITE profilePS5129418.67961IPR017930Myb domain
SuperFamilySSF466891.24E-2912108IPR009057Homeodomain-like
SMARTSM007171.5E-131363IPR001005SANT/Myb domain
PfamPF002493.0E-161461IPR001005SANT/Myb domain
CDDcd001671.87E-121761No hitNo description
PROSITE profilePS5129426.02362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.0E-2665117IPR009057Homeodomain-like
SMARTSM007171.7E-1666114IPR001005SANT/Myb domain
PfamPF002494.1E-1567110IPR001005SANT/Myb domain
CDDcd001673.31E-1269109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009071anatomyanther wall tapetum
PO:0001013developmental stageH late unicellular microspore stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MGHHSCCNKQ KVRRGLWSPE EDEKLVKYIS THGHGCWSSV PRLAGLQRCG KSCRLRWINY  60
LRPDLKRGSF SQQEESLIIE LHRVLGNRWA QIAKHLPGRT DNEVKNFWNS TIKKKLISQA  120
VGSLHPSSAD LYYNILDGAG QSIAAASLNA VENAAHGVTQ SPPSSVYNSA AWASFSSHQP  180
IFLPGHGVHG CGGGDLQYAA AVDGEFIRLC RAAEAYQLEN GAAGIVGGQC KPSDHLLAPE  240
GVVARSCLPA FVEQKGGGGG AFLADPAMGP VMDFMDAILG SSTTSAASAS SVDSFSANTA  300
MQPHWIP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31141167108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.383910.0flower| panicle| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154395040.0
Expression AtlasQ0JJY3-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g51260.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g51260
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2884870.0AK288487.1 Oryza sativa Japonica Group cDNA, clone: J090040H24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645252.10.0PREDICTED: myb-related protein Zm38
TrEMBLQ0JJY30.0Q0JJY3_ORYSJ; Os01g0709000 protein
STRINGLOC_Os01g51260.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP128133035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.21e-75myb domain protein 26