PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g50720.1
Common NameLOC4324241, Os01g0702700, OsJ_03162, OSNPB_010702700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 302aa    MW: 33199.9 Da    PI: 6.1746
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g50720.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.59.6e-161764148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g W++eEde+l++ + ++G g+W+++++  g+ R++k+c++rw +yl
  LOC_Os01g50720.1 17 KGLWSPEEDEKLYNHIYRYGVGCWSSVPKLAGLQRCGKSCRLRWINYL 64
                      678*******************************************97 PP

2Myb_DNA-binding483e-1570114147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg+++++E++ +v +++ lG++ W+ Ia++++ gRt++++k++w++ 
  LOC_Os01g50720.1  70 RGSFSQQEEDAIVGLHEILGNR-WSQIASHLP-GRTDNEIKNFWNSC 114
                       899*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.2E-241267IPR009057Homeodomain-like
PROSITE profilePS5129416.2441264IPR017930Myb domain
SuperFamilySSF466895.5E-2915111IPR009057Homeodomain-like
SMARTSM007174.9E-121666IPR001005SANT/Myb domain
PfamPF002492.1E-141764IPR001005SANT/Myb domain
CDDcd001672.04E-112064No hitNo description
PROSITE profilePS5129424.51765119IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2568119IPR009057Homeodomain-like
SMARTSM007172.2E-1469117IPR001005SANT/Myb domain
PfamPF002491.4E-1370114IPR001005SANT/Myb domain
CDDcd001672.30E-1072112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009037anatomylemma
PO:0001047developmental stagelemma development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MGRHACSAAG VQQKLRKGLW SPEEDEKLYN HIYRYGVGCW SSVPKLAGLQ RCGKSCRLRW  60
INYLRPDLKR GSFSQQEEDA IVGLHEILGN RWSQIASHLP GRTDNEIKNF WNSCLKKKLR  120
QRGIDPSTHQ PISTAAAAAA AALDTSTQDQ KPPATADGFA LKQQQQVFDP FPVIDSFGSG  180
FDATGMPLYG HLGGKDAAGF VDYSSVLDVS ENLGYGESSS NSSNWNCGVG APEVNNALES  240
EPLHWATESK VEPFVGYGEG DAMEHKFGLP CHGQQEQGMT HFDFDVSRSM VVGDFNFEYF  300
R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28151195108B-MYB
1h8a_C2e-281511925128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1114120LKKKLRQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.458920.0flower| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379884450.0
Expression AtlasQ0JK18-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g50720.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g50720
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1117820.0AK111782.1 Oryza sativa Japonica Group cDNA clone:J023084H22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633604.10.0PREDICTED: myb-related protein Hv33
SwissprotP200271e-106MYB3_HORVU; Myb-related protein Hv33
TrEMBLQ0JK180.0Q0JK18_ORYSJ; Os01g0702700 protein
STRINGLOC_Os01g50720.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP23273391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.13e-76myb domain protein 86