PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g49160.1
Common NameLOC9268190, P0445E10.33, P0478H03.23
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 319aa    MW: 33868.2 Da    PI: 8.0784
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g49160.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171462148
                      TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                      rg+W++eEdell  +v+ +G+g +W + +++ g++R++k+c++rw++yl
  LOC_Os01g49160.1 14 RGPWSPEEDELLRSYVRSHGTGgNWIALPQKAGLNRCGKSCRLRWLNYL 62
                      89*********************************************97 PP

2Myb_DNA-binding361.6e-1171111446
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        T +Ed ++  + +  G++ W+ Ia++++ gRt++++k++w++
  LOC_Os01g49160.1  71 YTDQEDRIICSLYNSIGSR-WSIIASKLP-GRTDNDVKNYWNT 111
                       699****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.218966IPR017930Myb domain
SuperFamilySSF466892.26E-2711109IPR009057Homeodomain-like
SMARTSM007178.4E-131364IPR001005SANT/Myb domain
PfamPF002491.4E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-241569IPR009057Homeodomain-like
CDDcd001679.18E-101662No hitNo description
PROSITE profilePS5129414.17667117IPR017930Myb domain
SMARTSM007173.4E-1167115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2170116IPR009057Homeodomain-like
PfamPF002494.6E-1070111IPR001005SANT/Myb domain
CDDcd001673.29E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MGRAPCCDKA SVKRGPWSPE EDELLRSYVR SHGTGGNWIA LPQKAGLNRC GKSCRLRWLN  60
YLRPDIKHGG YTDQEDRIIC SLYNSIGSRW SIIASKLPGR TDNDVKNYWN TKLKKKAMAM  120
HHHHQPPPPQ QQHYHHHHHH RVAGGGARVT LVSPPPAPQS QCASMQPSPA SASSSGGDAC  180
SFGAAAMYSP SPSTQQAPQA ATLAVAGYTS VATAAAAAAV AAQRSPLDEL ICQVPPPPTT  240
TAADCWASGV TLDDVFLPEL VGAGEFPNGD LFGGFGPLLQ DRSSMELSAC YFPNAAAAEM  300
WPAATDIVKP AGLCHSLT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25141177108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.49010.0callus| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2977202940.0
Expression AtlasQ8S0Z6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g49160.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g49160
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0034520.0AP003452.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0478H03.
GenBankAP0033470.0AP003347.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0445E10.
GenBankAK2431200.0AK243120.1 Oryza sativa Japonica Group cDNA, clone: J100028J01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631660.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0E0N0W50.0A0A0E0N0W5_ORYRU; Uncharacterized protein
TrEMBLA2WTV60.0A2WTV6_ORYSI; Putative uncharacterized protein
TrEMBLI1NQQ90.0I1NQQ9_ORYGL; Uncharacterized protein
TrEMBLQ8S0Z60.0Q8S0Z6_ORYSJ; Myb-related transcription factor LBM2-like
STRINGBGIOSGA004221-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os01g49160.10.0(Oryza sativa Japonica Group)
STRINGORGLA01G0219900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.14e-69myb domain protein 36