PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g48170.1
Common NameOJ1125_C04.27, P0007F06.9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HB-other
Protein Properties Length: 245aa    MW: 25767.5 Da    PI: 6.2896
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g48170.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.31.3e-1849103357
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                       kR   +++qle+Le+ ++ ++yps++ r+eL++k+gL++rq ++WF+ rR k++k
  LOC_Os01g48170.1  49 KRMMKSPYQLEVLEKTYAVEQYPSETLRAELSAKIGLSDRQLQMWFCHRRLKDRK 103
                       688999***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.98E-1736103IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-1736103IPR009057Homeodomain-like
PROSITE profilePS5007115.90444104IPR001356Homeobox domain
SMARTSM003893.1E-1546108IPR001356Homeobox domain
PfamPF000462.3E-1649103IPR001356Homeobox domain
CDDcd000861.46E-1649104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MDDGDGAAPA EGSAASTPPP APPAAAAAAA AAVSAGSTGA SGSGEKTVKR MMKSPYQLEV  60
LEKTYAVEQY PSETLRAELS AKIGLSDRQL QMWFCHRRLK DRKPPTKRQR REEEAAAVPL  120
MAPPPVLPPP ALPLSSGELL IGASSPYDEP PLPPVHSRRG AGRSSAVPRL SAPDIGRRYY  180
EPLPVMLPPP PVASMQLMPS ELRVIHSVES QLGEPLRDDG PVLGIDFDPL PPGSFGAPIV  240
VEIK*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ5QMQ5
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g48170.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g48170
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ9402100.0FJ940210.1 Oryza sativa Japonica Group clone KCS257D11 homeobox protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616412.11e-157PREDICTED: homeobox-DDT domain protein RLT2 isoform X1
TrEMBLA2WTN11e-170A2WTN1_ORYSI; Putative uncharacterized protein
TrEMBLA0A0E0FQW61e-170A0A0E0FQW6_ORYNI; Uncharacterized protein
TrEMBLA0A0E0N0K31e-170A0A0E0N0K3_ORYRU; Uncharacterized protein
TrEMBLQ5QMQ51e-170Q5QMQ5_ORYSJ; Homeobox transcription factor-like
STRINGBGIOSGA004179-PA1e-170(Oryza sativa Indica Group)
STRINGLOC_Os01g48170.11e-170(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP15771634
MonocotsOGMP1674079
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.24e-39Homeodomain-like transcriptional regulator