PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g47710.1
Common NameOs01g0667400, OSJNBb0063G05.20, WOX7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WOX
Protein Properties Length: 534aa    MW: 54799.5 Da    PI: 7.3957
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g47710.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox521.2e-1667127257
                       T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                       ++R+++ +eq+++Le+ F++   +p ++e+ ++ ++l    ++ +++V++WFqNr+ + k+
  LOC_Os01g47710.1  67 KPRWNPRPEQIRILEAIFNSgMVNPPRDEIPRIRMQLqeygQVGDANVFYWFQNRKSRSKN 127
                       89*****************99*************************************995 PP

2Wus_type_Homeobox110.21.1e-3566128264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++RW+P+peQi+iLe++++sG+++P+++ei ri+++L+eyG+++d+NVfyWFQNrk+R+++k
   LOC_Os01g47710.1  66 PKPRWNPRPEQIRILEAIFNSGMVNPPRDEIPRIRMQLQEYGQVGDANVFYWFQNRKSRSKNK 128
                        579**********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.89663128IPR001356Homeobox domain
SuperFamilySSF466895.13E-1165129IPR009057Homeodomain-like
SMARTSM003892.2E-665132IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.9E-666130IPR009057Homeodomain-like
CDDcd000862.13E-666128No hitNo description
PfamPF000462.6E-1467126IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0001081developmental stagemature plant embryo stage
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    Send to blast
MASSNRHWPS MFRSKHATQP WQTQPDMAGS PPSLLSGSSA GSAGGGGYSL KSSPFSSVGE  60
ERVPDPKPRW NPRPEQIRIL EAIFNSGMVN PPRDEIPRIR MQLQEYGQVG DANVFYWFQN  120
RKSRSKNKLR SGGTGRAGLG LGGNRASAPA AAHREAVAPS FTPPPPILPA PQPVQPQQQL  180
VSPVAAPTSS SSSSSDRSSG SSKPARATST QAMSVTTAMD LLSPLAAACH QQMLYQGQPL  240
ESPPAPAPKV HGIVPHDEPV FLQWPQSPCL SAVDLGAAIL GGQYMHLPVP APQPPSSPGA  300
AGMFWGLCND VQAPNNTGHK SCAWSAGLGQ HWCGSADQLG LGKSSAASIA TVSRPEEAHD  360
VDATKHGLLQ YGFGITTPQV HVDVTSSAAG VLPPVPSSPS PPNAAVTVAS VAATASLTDF  420
AASAISAGAV ANNQFQGLAD FGLVAGACSG AGAAAAAAAP EAGSSVAAVV CVSVAGAAPP  480
LFYPAAHFNV RHYGDEAELL RYRGGSRTEP VPVDESGVTV EPLQQGAVYI VVM*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.361850.0callus
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329742540.0
Expression AtlasQ0JKK6-
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g47710.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g47710
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0037600.0AP003760.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OSJNBb0063G05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638906.10.0PREDICTED: WUSCHEL-related homeobox 7
SwissprotQ0JKK60.0WOX7_ORYSJ; WUSCHEL-related homeobox 7
TrEMBLB8A7760.0B8A776_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA001059-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os01g47710.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1290845
MonocotsOGMP26663470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.17e-44homeobox-3
Publications ? help Back to Top
  1. Dai M,Hu Y,Zhao Y,Liu H,Zhou DX
    A WUSCHEL-LIKE HOMEOBOX gene represses a YABBY gene expression required for rice leaf development.
    Plant Physiol., 2007. 144(1): p. 380-90
    [PMID:17351053]