PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g47560.1
Common NameLOC4326856, Os01g0665500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 581aa    MW: 60890.5 Da    PI: 9.274
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g47560.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.84.7e-33370427259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +Dgy+WrKYGqK vk+s++prsYYrCt+++Cpvkk+vers +dp vv++tYeg+H+h+
  LOC_Os01g47560.1 370 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCPVKKRVERSYQDPAVVITTYEGKHTHP 427
                       8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.5E-35354429IPR003657WRKY domain
SuperFamilySSF1182901.96E-29361429IPR003657WRKY domain
PROSITE profilePS5081132.535364429IPR003657WRKY domain
SMARTSM007742.6E-39369428IPR003657WRKY domain
PfamPF031063.5E-26370427IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    Send to blast
MGVAVHWRRA GDSLHMGGEP RARAEAAWAA ALPAALVALV RDTATYTRMM HRLRMETPRG  60
PTCQLDPCCC CCTAHVIPPP PPVSRTHATR RDAEASVPPP PASAAVSSRS DGTGQMAAGV  120
TLACAAPPPL RAPRASDGGR RRGVVKGGAG TDTCRSPQRL NVRPRERERV RACVRARAKN  180
HEHGQRRREA AVDPAMSGEY QFQDELAPLF ARPGGGAGEM QMLPSSWFAD YLQAGTPMQM  240
DYDLMCRALE LPVGEDVKRE VGVVDVVAAG GGGAPPLTPN TTSSMSTSSS EGVGGGGGGG  300
AGAGAGEEES PARCKKEEDE NKEEGKGEED EGHKNKKGSA AKGGKAGKGE KRARQPRFAF  360
MTKSEVDHLE DGYRWRKYGQ KAVKNSPYPR SYYRCTTQKC PVKKRVERSY QDPAVVITTY  420
EGKHTHPIPA TLRGSTHLLA AHAQAAAAAA AAHQLHHHHG HHGHHGMAPP LPLGSGAAAQ  480
FGRSSGIDVL SSFLPRAAAA HHGMTTMGGA AATTTTSHGL NSAISGGGGV SSETTSAVTV  540
AASAQPSSPA ALQMQHFMAQ DLGLLQDMLL PSFIHGTNQP *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-27360430878Probable WRKY transcription factor 4
2lex_A3e-27360430878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.288280.0callus| flower| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO335191970.0
Expression AtlasQ0JKL7-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00440DAPTransfer from AT4G18170Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g47560.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g47560
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY8706040.0AY870604.1 Oryza sativa (japonica cultivar-group) WRKY16 mRNA, complete cds.
GenBankAY3418550.0AY341855.1 Oryza sativa (japonica cultivar-group) WRKY14 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640235.10.0PREDICTED: uncharacterized protein LOC4326856
TrEMBLQ0JKL70.0Q0JKL7_ORYSJ; Os01g0665500 protein
STRINGLOC_Os01g47560.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP62337173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.12e-47WRKY DNA-binding protein 71