PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g45860.1
Common NameLOC4325922, Os01g0646300, OsJ_02811, OSNPB_010646300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 496aa    MW: 52067.4 Da    PI: 4.8954
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g45860.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS421.47.7e-129864491374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlsel..aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                       lv+lL++cA a+++gd++la+a La  +    a ++++ + R+a +ft AL++rl+       + ++p +t     +e+++ ++ f+e++P+l
  LOC_Os01g45860.1  86 LVHLLMSCAGAIEAGDHALASAQLADSHAAlaAVSAASGIGRVAVHFTTALSRRLFP------SPVAPPTT----DAEHAFLYHHFYEACPYL 168
                       68***********************9998875667779******************9......44444444....4899999*********** PP

              GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak 184
                       kf+h+taNqaIlea++g+++vH+iDf+++qGlQWpaL+qaLa Rp+gpp lRiTg+g+p+++ ++el+ +g rLa++A++++v+f+f+ ++a+
  LOC_Os01g45860.1 169 KFAHFTANQAILEAFHGCDHVHVIDFSLMQGLQWPALIQALALRPGGPPFLRITGIGPPSPTGRDELRDVGLRLADLARSVRVRFSFRGVAAN 261
                       ********************************************************************************************* PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       +l+++++++L++ pgEa+a n+vlqlhrll ++++++  +d+vL++v s++Pk+++v+eqeadhn++ Fl+rf+eal yysa+fdsl+a  ++
  LOC_Os01g45860.1 262 SLDEVRPWMLQIAPGEAVAFNSVLQLHRLLGDPADQAP-IDAVLDCVASVRPKIFTVIEQEADHNKTGFLDRFTEALFYYSAVFDSLDAA-SA 352
                       ******************************99998888.************************************************998.44 PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                          + + + +++l+rei+++v+ ega+rrerhe l++Wr+rl++aG+++vpl+++a  qa++l+  ++++g++vee +g+l+lgW++rpL+s+
  LOC_Os01g45860.1 353 SGGAGNAMAEAYLQREICDIVCGEGAARRERHEPLSRWRDRLTRAGLSAVPLGSNALRQARMLVGLFSGEGHSVEEADGCLTLGWHGRPLFSA 445
                       558888888889********************************************************************************* PP

              GRAS 371 SaWr 374
                       SaW+
  LOC_Os01g45860.1 446 SAWE 449
                       ***5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.45360429IPR005202Transcription factor GRAS
PfamPF035142.6E-12686449IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0001081developmental stagemature plant embryo stage
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 496 aa     Download sequence    Send to blast
MAMDTFPFQW PMDPAASSGL DAGFLPPPAA VAPDDGVGYY DPPAGADVDA AALPEFAAAF  60
PPCAPDAAAA VLAMRREEEE VAGIRLVHLL MSCAGAIEAG DHALASAQLA DSHAALAAVS  120
AASGIGRVAV HFTTALSRRL FPSPVAPPTT DAEHAFLYHH FYEACPYLKF AHFTANQAIL  180
EAFHGCDHVH VIDFSLMQGL QWPALIQALA LRPGGPPFLR ITGIGPPSPT GRDELRDVGL  240
RLADLARSVR VRFSFRGVAA NSLDEVRPWM LQIAPGEAVA FNSVLQLHRL LGDPADQAPI  300
DAVLDCVASV RPKIFTVIEQ EADHNKTGFL DRFTEALFYY SAVFDSLDAA SASGGAGNAM  360
AEAYLQREIC DIVCGEGAAR RERHEPLSRW RDRLTRAGLS AVPLGSNALR QARMLVGLFS  420
GEGHSVEEAD GCLTLGWHGR PLFSASAWEA AGDGGGDNNN NSNSNVSGSS GSDSNNSGSS  480
NGKSSGARDG SSVCL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-60864484374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.415570.0flower| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1160117770.0
Expression AtlasB7F9I5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g45860.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g45860
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0032340.0AP003234.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0038D11.
GenBankAP0029100.0AP002910.1 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0707D10.
GenBankAK2424120.0AK242412.1 Oryza sativa Japonica Group cDNA, clone: J080076J05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624056.10.0PREDICTED: DELLA protein SLN1
SwissprotQ9LQT81e-131GAI_ARATH; DELLA protein GAI
TrEMBLB7F9I50.0B7F9I5_ORYSJ; Os01g0646300 protein
TrEMBLB8A6W00.0B8A6W0_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA001121-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os01g45860.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
MonocotsOGMP99838138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-115GRAS family protein