PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g45570.1
Common NameHOX3, LOC4326566, Os01g0643600, OsJ_002698
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 230aa    MW: 25122.6 Da    PI: 8.8657
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g45570.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.11.5e-1878131356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k+ +++keq + Lee F+ n++++ +++e LA kl+L  rqV vWFqNrRa+ k
  LOC_Os01g45570.1  78 KKLRLSKEQSRLLEESFRLNHTLTPKQKEALAIKLKLRPRQVEVWFQNRRARTK 131
                       67789***********************************************98 PP

2HD-ZIP_I/II121.15.8e-3978165289
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                       kk+rlskeq++lLEesF+ +++L+p++K++la +L+l+prqv+vWFqnrRARtk+kq+E+++e+Lkr++ +l+een+rL++eveeLr+
  LOC_Os01g45570.1  78 KKLRLSKEQSRLLEESFRLNHTLTPKQKEALAIKLKLRPRQVEVWFQNRRARTKLKQTEMECEYLKRCFGSLTEENRRLQREVEELRA 165
                       9*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.4E-1848134IPR009057Homeodomain-like
SuperFamilySSF466892.88E-1963134IPR009057Homeodomain-like
PROSITE profilePS5007116.84473133IPR001356Homeobox domain
SMARTSM003891.2E-1575137IPR001356Homeobox domain
CDDcd000865.18E-1576134No hitNo description
PfamPF000469.2E-1678131IPR001356Homeobox domain
PROSITE patternPS000270108131IPR017970Homeobox, conserved site
SMARTSM003407.1E-23133176IPR003106Leucine zipper, homeobox-associated
PfamPF021833.3E-10133166IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MMGATSPSGL ELTMAVPGLS SSGSEGAGCN NNNAGGGCNM RDLDINQPAS GGEEEEFPMG  60
SVEEDEEERG VGGPHRPKKL RLSKEQSRLL EESFRLNHTL TPKQKEALAI KLKLRPRQVE  120
VWFQNRRART KLKQTEMECE YLKRCFGSLT EENRRLQREV EELRAMRVAP PTVLSPHTRQ  180
PLPASALTMC PRCERITAAT GPPAVRPPPS SAAAAAPSPF HPRRPSAAF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1125133RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.81700.0panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO50068500.0
Expression AtlasQ0JKX1-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, nodes, internodes, flowers and embryo. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g45570.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g45570
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1457270.0AF145727.1 Oryza sativa homeodomain leucine zipper protein (Oshox3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645561.11e-166PREDICTED: homeobox-leucine zipper protein HOX3
SwissprotQ0JKX11e-168HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3
SwissprotQ9XH381e-168HOX3_ORYSI; Homeobox-leucine zipper protein HOX3
TrEMBLA0A0E0FQ531e-165A0A0E0FQ53_ORYNI; Uncharacterized protein
TrEMBLA0A0E0MZW61e-165A0A0E0MZW6_ORYRU; Uncharacterized protein
STRINGLOC_Os01g45570.11e-166(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
MonocotsOGMP68263549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.16e-62homeobox-leucine zipper protein 17
Publications ? help Back to Top
  1. Meijer AH,de Kam RJ,d'Erfurth I,Shen W,Hoge JH
    HD-Zip proteins of families I and II from rice: interactions and functional properties.
    Mol. Gen. Genet., 2000. 263(1): p. 12-21
    [PMID:10732669]
  2. Agalou A, et al.
    A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members.
    Plant Mol. Biol., 2008. 66(1-2): p. 87-103
    [PMID:17999151]