PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g45090.1
Common NameOs01g0637800, OSNPB_010637800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 229aa    MW: 25448.5 Da    PI: 6.7919
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g45090.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.8e-171663148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT eEd++lv ++ q G g+W+  ar  g++R +k+c++rw++yl
  LOC_Os01g45090.1 16 KGPWTLEEDLILVSYISQNGEGSWDNLARSAGLNRNGKSCRLRWLNYL 63
                      79********************************************97 PP

2Myb_DNA-binding51.91.7e-1669112146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+ T+eEd  + +++ ++G++ W++Ia++++ gRt++++k++w++
  LOC_Os01g45090.1  69 RGSITPEEDMVIRELHSRWGNR-WSKIAKHLP-GRTDNEIKNYWRT 112
                       7889******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.3471163IPR017930Myb domain
SuperFamilySSF466897.99E-3114110IPR009057Homeodomain-like
SMARTSM007174.2E-131565IPR001005SANT/Myb domain
PfamPF002491.2E-141663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-201769IPR009057Homeodomain-like
CDDcd001671.59E-91863No hitNo description
PROSITE profilePS5129424.3664118IPR017930Myb domain
SMARTSM007171.3E-1568116IPR001005SANT/Myb domain
PfamPF002495.0E-1569112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-2470117IPR009057Homeodomain-like
CDDcd001674.21E-1273112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MATRMCGRAG EPAVRKGPWT LEEDLILVSY ISQNGEGSWD NLARSAGLNR NGKSCRLRWL  60
NYLRPGVRRG SITPEEDMVI RELHSRWGNR WSKIAKHLPG RTDNEIKNYW RTKIHRKPRG  120
RSQLLQEPCE DAMGMGMSTT TSEAASTSAS SGQSQASPGV WDEYMQASSF PHPELVSFAA  180
DHHLEMAGVG EVAAAAAAQF VPTEFGFNDG FWNFVDNFWE TMPVSDVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-281211723127MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.792240.0panicle| seed
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasA0A0P0V5Q1
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g45090.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g45090
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0043670.0AP004367.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0696E01.
GenBankAP0036070.0AP003607.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0004A09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642897.11e-171PREDICTED: myb-related protein 305
TrEMBLA0A0P0V5Q11e-171A0A0P0V5Q1_ORYSJ; Os01g0637800 protein (Fragment)
STRINGLOC_Os01g45090.11e-171(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP132402633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.11e-58myb domain protein 21