PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g43650.1
Common NameLOC4326690, Os01g0626400, OsJ_02674, OSNPB_010626400, P0006C01.25, P0688A04.3, WRKY11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 380aa    MW: 39856 Da    PI: 7.0634
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g43650.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1023.3e-32205262259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +Dgy+WrKYGqK vk+s++prsYYrCt+++C vkk+vers +dp++v++tYeg+H+h+
  LOC_Os01g43650.1 205 EDGYRWRKYGQKAVKNSPYPRSYYRCTTPKCGVKKRVERSYQDPSTVITTYEGQHTHH 262
                       8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.0E-34189264IPR003657WRKY domain
SuperFamilySSF1182907.98E-29197264IPR003657WRKY domain
PROSITE profilePS5081131.066199264IPR003657WRKY domain
SMARTSM007741.6E-37204263IPR003657WRKY domain
PfamPF031062.3E-25205262IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009038anatomypalea
PO:0001048developmental stagepalea development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MSSGGGGGGG GDRHGPYHQH GHLGRGEGAD YVYSSSDMES FFFSQPGGVG IGGGGGGVVG  60
AGGADEIMPY SSITDYLQGL LDPSGLARHL DVACPSSQDT VVKQELSVDV TSHDSQGTGG  120
VAGEGVAQAT PNSSASFSSS DGEAEGGKSS RRCKKGQAKA EEEDDKDEED GENSKKPNKP  180
KKKAEKRQRQ PRVAFLTKSE VDHLEDGYRW RKYGQKAVKN SPYPRSYYRC TTPKCGVKKR  240
VERSYQDPST VITTYEGQHT HHSPASLRGG GGGVGIVGGH HHHHLFMPGV HGLPPSHLMP  300
AGFHPELMGL MHHHPAMAAA AANPSMYFPG VAASAPPPPA VAGGGAMPPN DHPPLQQHHF  360
TDYALLQDLF PSTMPSSNP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-291972651078Probable WRKY transcription factor 4
2lex_A4e-291972651078Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.305120.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329939540.0
Expression AtlasQ9FE35-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g43650.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g43650
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3418560.0AY341856.1 Oryza sativa (japonica cultivar-group) WRKY16 mRNA, complete cds.
GenBankAK1087450.0AK108745.1 Oryza sativa Japonica Group cDNA clone:002-150-E09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626307.10.0PREDICTED: probable WRKY transcription factor 71
TrEMBLQ9FE350.0Q9FE35_ORYSJ; DNA-binding protein WRKY2-like
STRINGLOC_Os01g43650.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP62337173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.16e-42WRKY DNA-binding protein 71
Publications ? help Back to Top
  1. Zhang ZL, et al.
    A rice WRKY gene encodes a transcriptional repressor of the gibberellin signaling pathway in aleurone cells.
    Plant Physiol., 2004. 134(4): p. 1500-13
    [PMID:15047897]