PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g43590.1
Common NameHSF02, HSF13, HSFC1A, LOC4326685, Os01g0625300, OsJ_002575, OsJ_02668, P0006C01.11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HSF
Protein Properties Length: 349aa    MW: 37755.8 Da    PI: 6.691
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g43590.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind92.84e-29271272102
                       HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE---SSBTTTTXTTSEEEEESXXXXXXXXXX CS
      HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkdeekkskskekiweFkhksFkkgkkell 94 
                       F+ k+y+++ d++++ l++w +++nsfvv+d+  f++ +Lp +Fkh nf+SFvRQLn+Y     +   + +k +++ weF+h+sF +g+++ll
  LOC_Os01g43590.1  27 FVAKTYQMVCDPRTDALVRWGRDNNSFVVVDPAAFSQLLLPCFFKHGNFSSFVRQLNTYVSIIQSPAPGFRKVHPDRWEFAHESFLRGQTHLL 119
                       9**********************************************************877766666666667999**************** PP

                       XXXXXXXX CS
      HSF_DNA-bind  95 ekikrkks 102
                        +i r+k+
  LOC_Os01g43590.1 120 PRIVRRKK 127
                       *****987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.105.5E-3422125IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004158.8E-4623125IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467854.9E-3223125IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000564.5E-102750IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004471.3E-2627125IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000564.5E-106577IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000564.5E-107890IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MDGLHTELAL GLIGCCGGDG QQQTAPFVAK TYQMVCDPRT DALVRWGRDN NSFVVVDPAA  60
FSQLLLPCFF KHGNFSSFVR QLNTYVSIIQ SPAPGFRKVH PDRWEFAHES FLRGQTHLLP  120
RIVRRKKRGE GGGGGGGASC SFGGGAGEHQ VAAAAASVGM SGEEEDAAED VLAKEAALFE  180
EVQRLRHEQT AIGEELARMS QRLQATERRP DQLMSFLAKL ADDPNAVTGH LLEQAAERKR  240
RRQHLPSHEP TVCPLPPAPP PQPPQPLLAL AGAAAMDGTY WWTTEHHHHH HHQMKPMTVL  300
PSLEPPTASC GVHQVPELGG GGVMGLTTDG EAKVEPPFPF CLLGQAFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B3e-201712519129Heat shock factor protein 1
5d5v_B3e-201712519129Heat shock factor protein 1
5d5v_D3e-201712519129Heat shock factor protein 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1237241RKRRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.400150.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329795030.0
Expression AtlasQ6VBA4-
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g43590.1
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g43590
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3444950.0AY344495.1 Oryza sativa (japonica cultivar-group) heat shock factor RHSF13 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636084.10.0PREDICTED: heat stress transcription factor C-1a
SwissprotQ6VBA40.0HFC1A_ORYSJ; Heat stress transcription factor C-1a
TrEMBLI1NPU20.0I1NPU2_ORYGL; Uncharacterized protein
STRINGLOC_Os01g43590.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1290245
MonocotsOGMP12137394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24520.19e-54heat shock transcription factor C1
Publications ? help Back to Top
  1. Baniwal SK, et al.
    Heat stress response in plants: a complex game with chaperones and more than twenty heat stress transcription factors.
    J. Biosci., 2004. 29(4): p. 471-87
    [PMID:15625403]
  2. Guo J, et al.
    Genome-wide analysis of heat shock transcription factor families in rice and Arabidopsis.
    J Genet Genomics, 2008. 35(2): p. 105-18
    [PMID:18407058]