PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g43180.1
Common NameB1040D09.18, P0407B12.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 108aa    MW: 11984.5 Da    PI: 6.517
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g43180.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding346.9e-1162100444
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
   Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                       +T+eE+++  + +++ G++ W++Ia +++ gRt++++  +w
  LOC_Os01g43180.1  62 FTEEEEDIVFRMHRLVGNR-WELIAGRIP-GRTAEEVEKFW 100
                       9******************.*********.*******9999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.31454107IPR017930Myb domain
SMARTSM007173.5E-858106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-1361100IPR009057Homeodomain-like
SuperFamilySSF466898.58E-961101IPR009057Homeodomain-like
CDDcd001672.24E-962100No hitNo description
PfamPF002498.5E-1062100IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009913Biological Processepidermal cell differentiation
GO:0010063Biological Processpositive regulation of trichoblast fate specification
GO:0010091Biological Processtrichome branching
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048765Biological Processroot hair cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 108 aa     Download sequence    Send to blast
MESSGGSQLG KNSKTSDGRE TKATSSLLLL ITAIHFVALC PKGENEDARK EVNSTAQNFV  60
HFTEEEEDIV FRMHRLVGNR WELIAGRIPG RTAEEVEKFW AIKHQAT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.412423e-53callus| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ5ZBH0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g43180.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g43180
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519334e-55JF951933.1 Aegilops speltoides clone TaMYB50 MYB-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006644376.17e-39PREDICTED: MYB-like transcription factor ETC3 isoform X1
RefseqXP_006644377.17e-39PREDICTED: MYB-like transcription factor ETC3 isoform X1
RefseqXP_015697875.17e-39PREDICTED: MYB-like transcription factor ETC3 isoform X1
SwissprotO220593e-20CPC_ARATH; Transcription factor CPC
SwissprotQ8GV053e-20TRY_ARATH; Transcription factor TRY
TrEMBLA0A0E0MZC58e-75A0A0E0MZC5_ORYRU; Uncharacterized protein
TrEMBLQ5ZBH08e-75Q5ZBH0_ORYSJ; Uncharacterized protein
STRINGLOC_Os01g43180.12e-74(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP4207823
MonocotsOGMP52753157
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01060.29e-22CAPRICE-like MYB3