PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g41900.1
Common NameB1085F01.29-1, LOC4324094, Os01g0603300, OsJ_02512, OSNPB_010603300, P0681B11.9-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 302aa    MW: 31280.8 Da    PI: 7.6173
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g41900.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.62.9e-13134178347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +W++eE+ l++ + ++lG+g+W+ I+r   ++Rt+ q+ s+ qk+
  LOC_Os01g41900.1 134 PWSEEEHRLFLVGLEKLGKGDWRGISRSYVTTRTPTQVASHAQKF 178
                       8******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.403127183IPR017930Myb domain
SuperFamilySSF466896.5E-17128184IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-17130182IPR006447Myb domain, plants
SMARTSM007178.5E-10131181IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-10131174IPR009057Homeodomain-like
PfamPF002491.5E-10134177IPR001005SANT/Myb domain
CDDcd001672.44E-9134179No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006338Biological Processchromatin remodeling
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0035066Biological Processpositive regulation of histone acetylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0004402Molecular Functionhistone acetyltransferase activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MARKCSYCGN YGHNSRTCSS SASAGHRDTT MLCDGGDGGG GSGLRLFGVQ VHVAAGGGGG  60
GGGGGLPMKK SYSMDCLQLA AAGAAPGSLV SPSSSSSSSM LLSIDEGGLE RASNGYLSDG  120
PHGRIVQERK KGVPWSEEEH RLFLVGLEKL GKGDWRGISR SYVTTRTPTQ VASHAQKFFL  180
RQSSIGKKKR RSSLFDMVPI CENGARVSEQ LSGEGAAAAA AASTSLSLMN THETSSDRVA  240
AIDLNSTEED DTVGASGRPF FPVVLMEQQQ QASHGHGHHH HCTPLDLELG MSVSSTPSIG  300
T*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1186190KKKRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.151380.0callus| flower| leaf| panicle| root| stem| vegetative meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329886410.0
Expression AtlasQ8W0M6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g41900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g41900
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1034320.0AK103432.1 Oryza sativa Japonica Group cDNA clone:J033128P13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648805.10.0PREDICTED: uncharacterized protein LOC4324094
TrEMBLA0A0E0MYY70.0A0A0E0MYY7_ORYRU; Uncharacterized protein
TrEMBLQ8W0M60.0Q8W0M6_ORYSJ; Os01g0603300 protein
STRINGLOC_Os01g41900.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3941699
MonocotsOGMP49323066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.14e-45MYB_related family protein