PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g40260.1
Common NameLOC4327651, Os01g0584900, OsJ_02377, OSJNBb0024F06.22, OSNPB_010584900, P0712E02.9, WRKY77
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 247aa    MW: 26500.7 Da    PI: 7.6528
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g40260.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.64.1e-31136194159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYG+K+vk+s++pr+YYrC+s+gC+vkk+ver+++d ++v++tY g Hnh+
  LOC_Os01g40260.1 136 LDDGYRWRKYGKKMVKNSPNPRNYYRCSSEGCRVKKRVERARDDARFVVTTYDGVHNHP 194
                       59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.8E-33123196IPR003657WRKY domain
SuperFamilySSF1182903.53E-28129196IPR003657WRKY domain
PROSITE profilePS5081133.35131196IPR003657WRKY domain
SMARTSM007741.1E-36136195IPR003657WRKY domain
PfamPF031062.3E-24137194IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MSSLYPSLLS LSESPAEYRQ VGGGRYAGED VVDDDDDMAA VADAVSSYLS FDMDDVEYYT  60
PEVGFHSKQH NPPPVAAAPL EAGGGREQSR REAAVNLGKM DRGPAPVSGG AATGGVPRSK  120
NGSKIAFKTR SEVDVLDDGY RWRKYGKKMV KNSPNPRNYY RCSSEGCRVK KRVERARDDA  180
RFVVTTYDGV HNHPAPLHLR PQLPPPGGYS IAGAPAVVAP HGRLGLEEAE VIALFRGTTA  240
TSLLLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-26127196877Probable WRKY transcription factor 4
2lex_A3e-26127196877Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.306570.0callus| leaf| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329937310.0
Expression AtlasQ94D50-
Function -- GeneRIF ? help Back to Top
  1. WRKY77 localises in the nucleus and is a transcriptional activator
    [PMID: 23061987]
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g40260.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g40260
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3418460.0AY341846.1 Oryza sativa (japonica cultivar-group) WRKY5 mRNA, complete cds.
GenBankAK1085220.0AK108522.1 Oryza sativa Japonica Group cDNA clone:002-144-B05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635031.11e-180PREDICTED: WRKY transcription factor SUSIBA2
TrEMBLQ94D501e-180Q94D50_ORYSJ; Os01g0584900 protein
STRINGLOC_Os01g40260.11e-180(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP44137206
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.18e-38WRKY DNA-binding protein 50
Publications ? help Back to Top
  1. Zhang ZL, et al.
    A rice WRKY gene encodes a transcriptional repressor of the gibberellin signaling pathway in aleurone cells.
    Plant Physiol., 2004. 134(4): p. 1500-13
    [PMID:15047897]
  2. Xie Z, et al.
    Annotations and functional analyses of the rice WRKY gene superfamily reveal positive and negative regulators of abscisic acid signaling in aleurone cells.
    Plant Physiol., 2005. 137(1): p. 176-89
    [PMID:15618416]
  3. Lan A, et al.
    A salicylic acid-induced rice (Oryza sativa L.) transcription factor OsWRKY77 is involved in disease resistance of Arabidopsis thaliana.
    Plant Biol (Stuttg), 2013. 15(3): p. 452-61
    [PMID:23061987]