PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g39150.1
Common NameB1129G05.32, B1151A10.13, Os01g0572800, OsJ_02299, OSNPB_010572800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family LBD
Protein Properties Length: 252aa    MW: 26857 Da    PI: 6.0269
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g39150.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.36e-3940137198
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       aCaaCk++rr+C+++C la+yfpa+qp++f+n+h+lFG +n+l+++++++ee r+dam+s+vye++a++ dP  Ga+g+++ l+q+l++lkae
  LOC_Os01g39150.1  40 ACAACKHQRRRCTPECRLARYFPANQPARFRNAHRLFGIKNILRVMASASEELRDDAMKSVVYESDAWVIDPLGGAAGIVKGLSQELARLKAE 132
                       7******************************************************************************************** PP

            DUF260  94 lallk 98 
                       l+++k
  LOC_Os01g39150.1 133 LDAVK 137
                       *9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.51739140IPR004883Lateral organ boundaries, LOB
PfamPF031956.0E-3540137IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MGDEEAGPSS SGHSSPTSNT STTPPPQPPP PPPPPPHPQA CAACKHQRRR CTPECRLARY  60
FPANQPARFR NAHRLFGIKN ILRVMASASE ELRDDAMKSV VYESDAWVID PLGGAAGIVK  120
GLSQELARLK AELDAVKGLI ELHRRAAAQQ QQQPPVAVAS NGGFLPSPPP PPQGQQQLLF  180
LPPPPPTMML QDGHCDDETV EDDYLVDPPA VDAAAATSTA PERHGDGHAP PANVKEEGNV  240
DHTSSISFRD R*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ8L3S3
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g39150.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g39150
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0034130.0AP003413.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1151A10.
GenBankAP0033080.0AP003308.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1129G05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638299.12e-97PREDICTED: LOB domain-containing protein 11-like
TrEMBLQ8L3S30.0Q8L3S3_ORYSJ; Lateral organ boundaries (LOB) domain protein-like
STRINGLOC_Os01g39150.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
MonocotsOGMP158291113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.14e-27LOB domain-containing protein 22