PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g37100.1
Common NameOSJNBa0024F24.43, OSJNBa0066C06.12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Nin-like
Protein Properties Length: 442aa    MW: 47810.2 Da    PI: 6.4628
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g37100.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK85.35.4e-27284333352
            RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ++i +edl++yF++pi++AA+e++v+lTvLK++CR++G++RWPhRk+ksl
  LOC_Os01g37100.1 284 DHIGFEDLRRYFYMPITKAAREMNVGLTVLKKRCRELGVARWPHRKMKSL 333
                       6899********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.496273353IPR003035RWP-RK domain
PfamPF020423.7E-21286333IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MEMHECCYYG GSIGGDWLNP LAAIPPPCSS SSSSWSSQLL LLSDHDDVLL HSAGDHGGAV  60
AGIGGACMTA DLVVRDEEME MAAGYLPVAA SAAAAADVDH YMYQQFQLEP DQFVSTLPAV  120
AVAVAATAGG GSHDDELLRM PFTDIDLDAF ADARDVVVGV GEPKPSPQHT LDAAIALPAV  180
GGGGAHHFGT QDDDVKFDVT KQRNDAALAG DDSLSMVIVE SYEMGMRRHA AEQEQEQKPK  240
IITSAATTLT PLPLPPPPPP PPRVTRSRRD GSSAATAGGK TRLDHIGFED LRRYFYMPIT  300
KAAREMNVGL TVLKKRCREL GVARWPHRKM KSLKSLILNE MGSKGMSAAA MRRELEALEN  360
CCALMERNPA VELTERTKKL RQACFKENYK RRRAAAVDVL DLDHCFSFAA GHCHRHHHQQ  420
LALPPPPAAA ADHRRRDFFG Y*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ8RYX0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g37100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g37100
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126090.0CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0042580.0AP004258.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OSJNBa0024F24.
GenBankAP0039330.0AP003933.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OSJNBa0066C06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638205.10.0PREDICTED: uncharacterized protein LOC107276829
TrEMBLA0A0D3EQ180.0A0A0D3EQ18_9ORYZ; Uncharacterized protein
TrEMBLQ8RYX00.0Q8RYX0_ORYSJ; Pentatricopeptide (PPR) repeat-containing protein-like
STRINGLOC_Os01g37100.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5671777
MonocotsOGMP128882330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.14e-31RWP-RK domain-containing protein