PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g36460.1
Common NameLOC9267667, OsJ_02147
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 358aa    MW: 38499.7 Da    PI: 6.07
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g36460.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.4e-161764148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg W++eEde+l + + ++G g+W+++++  g+ R++k+c++rw +yl
  LOC_Os01g36460.1 17 RGLWSPEEDEKLFNHISRYGVGCWSSVPKLAGLERCGKSCRLRWINYL 64
                      788*******************************************97 PP

2Myb_DNA-binding51.62.2e-1670113146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+++++E+el++ ++k lG++ W+ Ia+ ++ gRt++++k++w++
  LOC_Os01g36460.1  70 RGSFSQQEEELIISLHKILGNR-WSQIAAQLP-GRTDNEIKNFWNS 113
                       899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-24967IPR009057Homeodomain-like
PROSITE profilePS5129418.8451264IPR017930Myb domain
SuperFamilySSF466893.0E-2914111IPR009057Homeodomain-like
SMARTSM007173.0E-131666IPR001005SANT/Myb domain
PfamPF002492.2E-141764IPR001005SANT/Myb domain
CDDcd001677.88E-122064No hitNo description
PROSITE profilePS5129426.13965119IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-2668119IPR009057Homeodomain-like
SMARTSM007178.7E-1669117IPR001005SANT/Myb domain
PfamPF002499.3E-1570114IPR001005SANT/Myb domain
CDDcd001671.70E-1172112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MGRESAAACS PKPKLRRGLW SPEEDEKLFN HISRYGVGCW SSVPKLAGLE RCGKSCRLRW  60
INYLRPDLKR GSFSQQEEEL IISLHKILGN RWSQIAAQLP GRTDNEIKNF WNSCLKKKLR  120
QRGIDPATHK PLNDGGAGAG EEHHDDGDKQ QLMDDVDDCF AIGGGGSSDS LAPPHSPAVS  180
FDPLSVTNVP TTMMQSSSSP YGAAGGEHSS FRSDTLCDYG GSGGGVDVVS DAGTYSAYTG  240
DSSSNSNSTA WTCGSVVVGG AGELPPPPLL PHMDMFGRVD AEPPPYPPFD VQARFSPWHH  300
HHHHHHEPTL PTPPQRLDGG GGAAASFPIR SLSRDMPESC FDLGRGALDD EFGVDFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31131193108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1114120LKKKLRQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.101150.0panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2977200820.0
Expression AtlasA2ZU62-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g36460.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g36460
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0042320.0AP004232.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OSJNBa0051H17.
GenBankAP0042310.0AP004231.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OSJNBa0026J14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015643158.10.0PREDICTED: myb-related protein Hv33
SwissprotP200274e-74MYB3_HORVU; Myb-related protein Hv33
TrEMBLA0A0E0MXS00.0A0A0E0MXS0_ORYRU; Uncharacterized protein
TrEMBLA2ZU620.0A2ZU62_ORYSJ; Uncharacterized protein
STRINGLOC_Os01g36460.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP111643041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.13e-75myb domain protein 86