PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g29840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 334aa    MW: 37382.6 Da    PI: 6.7805
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g29840.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.61.7e-55141421128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                       lppGfrFhPtdee++++yL++kv +++  +  +i evd++k+ePwdLp k+  ++ekewyf++++d+ky+tg r+nrat++gyWkatgkdke+
  LOC_Os01g29840.1  14 LPPGFRFHPTDEEIITFYLAPKVVDSRGFCVAAIGEVDLNKCEPWDLPgKAKMNGEKEWYFYCQKDRKYPTGMRTNRATEAGYWKATGKDKEI 106
                       79********************99999556588***************544445788************************************ PP

               NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +++++ l+g+kktLvfykgrapkg kt+Wvmheyrl
  LOC_Os01g29840.1 107 FRNHHMLIGMKKTLVFYKGRAPKGDKTNWVMHEYRL 142
                       **********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-6210173IPR003441NAC domain
PROSITE profilePS5100559.40514173IPR003441NAC domain
PfamPF023653.2E-2815142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MGEQQQQVER QPDLPPGFRF HPTDEEIITF YLAPKVVDSR GFCVAAIGEV DLNKCEPWDL  60
PGKAKMNGEK EWYFYCQKDR KYPTGMRTNR ATEAGYWKAT GKDKEIFRNH HMLIGMKKTL  120
VFYKGRAPKG DKTNWVMHEY RLADASPPQP PPPPSSAEPP RQDDWAVCRI FHKSSGIKKP  180
VQVPMQMPMQ MQMPVAHQVP AANYQQQMAM ASASIIQVPM QMQMPSMSDQ LQMLDDFSTG  240
SLMAPPPPPP SYSTLPGFPL QINGGAQQFV GNPSMYYQQQ QQQQQQQMDM AAGGFVVSEP  300
SSLVVSPQDA ADQNNAADIS SVACNMDATI WKY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D5e-5211797174NAC domain-containing protein 19
3swp_C5e-5211797174NAC domain-containing protein 19
3swp_B5e-5211797174NAC domain-containing protein 19
3swp_A5e-5211797174NAC domain-containing protein 19
3swm_D5e-5211797174NAC domain-containing protein 19
3swm_C5e-5211797174NAC domain-containing protein 19
3swm_B5e-5211797174NAC domain-containing protein 19
3swm_A5e-5211797174NAC domain-containing protein 19
4dul_B6e-5211794171NAC domain-containing protein 19
4dul_A6e-5211794171NAC domain-containing protein 19
1ut7_B6e-5211794171NO APICAL MERISTEM PROTEIN
1ut7_A6e-5211794171NO APICAL MERISTEM PROTEIN
1ut4_B6e-5211794171NO APICAL MERISTEM PROTEIN
1ut4_A6e-5211794171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.183370.0flower| panicle| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2139591280.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g29840.1
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g29840
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8469950.0EU846995.1 Oryza sativa Japonica Group clone KCS259A08 NAC protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629856.10.0PREDICTED: NAC transcription factor ONAC010-like
SwissprotQ9FLR35e-78NAC79_ARATH; NAC domain-containing protein 79
TrEMBLA0A0E0FLS50.0A0A0E0FLS5_ORYNI; Uncharacterized protein
TrEMBLA0A0E0MWS60.0A0A0E0MWS6_ORYRU; Uncharacterized protein
TrEMBLA2WQE40.0A2WQE4_ORYSI; Putative uncharacterized protein
STRINGLOC_Os01g29840.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA001578-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.23e-78Arabidopsis NAC domain containing protein 87