PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g24070.1
Common NameB1045F02.28, LOC4326489, Os01g0343300, OSNPB_010343300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GATA
Protein Properties Length: 132aa    MW: 14138 Da    PI: 9.5313
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g24070.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA61.88.5e-202155135
              GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                      C+ C++t+Tp+WR+gp g+++LCnaCG++yrkk++
  LOC_Os01g24070.1 21 CVECRATTTPMWRSGPTGPRSLCNACGIRYRKKRR 55
                      ********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.8481551IPR000679Zinc finger, GATA-type
SMARTSM004012.6E-151565IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.52E-131855No hitNo description
Gene3DG3DSA:3.30.50.103.7E-161956IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.71E-132056No hitNo description
PROSITE patternPS0034402146IPR000679Zinc finger, GATA-type
PfamPF003201.5E-172155IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MGSTDRKVVG IGVAEEGRRS CVECRATTTP MWRSGPTGPR SLCNACGIRY RKKRRQDLGL  60
DLNQPQKQEH GEVIPEVKDS NSNSNNCNSG SGNSSSNLQV VPKRRLLMGV EEAALLLMTL  120
SSPSASTLLH G*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.212390.0callus| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166396650.0
Expression AtlasQ8LQW5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g24070.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g24070
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8415700.0CT841570.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C102C07, full insert sequence.
GenBankCT8296260.0CT829626.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA214F08, full insert sequence.
GenBankBT1324000.0BT132400.1 Oryza sativa clone RRlibD00393 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621366.14e-92PREDICTED: GATA transcription factor 23
TrEMBLA0A0E0MVX14e-92A0A0E0MVX1_ORYRU; Uncharacterized protein
TrEMBLQ8LQW54e-92Q8LQW5_ORYSJ; Os01g0343300 protein
STRINGLOC_Os01g24070.11e-91(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
MonocotsOGMP67212854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26930.13e-18GATA transcription factor 23