PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g23770.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 324aa    MW: 34463.4 Da    PI: 7.2348
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g23770.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF40.53.4e-131645837
                      HHHHHHHHHHHHHHHHHHHHHHHHT-EEEE CS
            SRF-TF  8 nrqvtfskRrngilKKAeELSvLCdaevav 37
                      +r  tf++R+++++K A+ELSvLCda+vav
  LOC_Os01g23770.1 16 KRAATFARRKETVMKMAKELSVLCDAQVAV 45
                      6899************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-4153IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.689145IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-12145IPR002100Transcription factor, MADS-box
CDDcd002662.57E-16345No hitNo description
PfamPF003191.1E-101545IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MPRAKTPMGL IPFPKKRAAT FARRKETVMK MAKELSVLCD AQVAVRAKRS LTHREYLRGE  60
LRKQRAKLAK VREEGAFKPW DDALDGIAEE ETRKLHKYLS DKIEAARARM EAMGLQLGDV  120
DDNGVNGDDG GGLDLQQHVP PSASDAKEFE SVPVVHGGQY IGSSSGGGGG DIQMQTTPAA  180
DGISFAEHFL VAPRAQPLAF STAGADFINA PNNFLTTGVS VSDYSVQSSG YGIGNQIDNA  240
KQLLYQMQMQ YPVGGTGGAE PSNTQTQSPD LRSFSNVVGD YSYTAAQSSA NRLDQMHHPV  300
GGRGSTGGAA ADPSDTQSKN RGS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g23770.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g23770
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0033310.0AP003331.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1088D01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLQ5ZBA60.0Q5ZBA6_ORYSJ; Putative uncharacterized protein B1088D01.25
STRINGLOC_Os01g23770.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45722960