PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g23760.1
Common NameB1088D01.23, Os01g0340100, OSNPB_010340100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 408aa    MW: 42728.2 Da    PI: 4.3805
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g23760.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF40.82.9e-131350542
                      SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
            SRF-TF  5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                         +r  t++kR++ + KKAeELS+LC+++va + +++
  LOC_Os01g23760.1 13 HRQKRAATYAKRKESLRKKAEELSTLCGVRVAFVCAGP 50
                      567899**************************999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.558146IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-15185IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-7150IPR002100Transcription factor, MADS-box
CDDcd002661.08E-18289No hitNo description
PRINTSPR004045.5E-5323IPR002100Transcription factor, MADS-box
PfamPF003191.9E-131150IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-52338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MARRKIPIGL IAHRQKRAAT YAKRKESLRK KAEELSTLCG VRVAFVCAGP VVPGGGGGAA  60
GKEEVWESEE GVLAEYRALP PEARAQHAHR VYLEEEVGKE RAKLARVRQD GAFPSWDAAL  120
DGITADEARA LLESIDAARA AANARREALG LPDDGNGVDD DGGLDLQQQQ EHVPPGGSDA  180
VVVPVGHGVL QYTGSGGGNQ MQTTPAADGI NCADLYGAVP WDDTFQPQVM RTGDHFVPMD  240
GYLWQAPGNG WPDLATGCTN ESCSCNAAAA AAAMPAMYPP TLDTVHGSFL AAPAQPIPIA  300
FSTSTDFIDA PNDFLTMGLC GGFTNVGDYS AAQPQSSADG GFQLGDTFAA EPGDTQSQNW  360
GSFINVVSDD SAQCNCNAAI HLDQMYYLFG GTGGGEPSDT QSRHWGS*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ942L1
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g23760.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g23760
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126090.0CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0033310.0AP003331.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1088D01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0E0MVU90.0A0A0E0MVU9_ORYRU; Uncharacterized protein
TrEMBLA2WPI10.0A2WPI1_ORYSI; Putative uncharacterized protein
TrEMBLQ942L10.0Q942L1_ORYSJ; Os01g0340100 protein
STRINGBGIOSGA003441-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os01g23760.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP150691120
Representative plantOGRP1164635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31630.18e-11AGAMOUS-like 86