PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g19970.1
Common NameLOC4323911, Os01g0305900, OsJ_01463, OSNPB_010305900, P0475H04.46, P0552C05.25
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 318aa    MW: 33646.1 Da    PI: 5.4688
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g19970.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-161461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rgrWT+eEde+l++++++ G g W++ ++  g+ R++k+c++rw +yl
  LOC_Os01g19970.1 14 RGRWTKEEDEKLARYIRENGEGAWRSMPKNAGLLRCGKSCRLRWINYL 61
                      8*******************************99************97 PP

2Myb_DNA-binding51.22.9e-1667112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg+ +++E+++++++++ lG++ W++Ia +++ gRt++++k++w+++l
  LOC_Os01g19970.1  67 RGNISPQEEDIILNLHATLGNR-WSLIAGHLP-GRTDNEIKNYWNSHL 112
                       7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.1E-22564IPR009057Homeodomain-like
PROSITE profilePS5129415.974961IPR017930Myb domain
SuperFamilySSF466891.8E-2711108IPR009057Homeodomain-like
SMARTSM007177.4E-121363IPR001005SANT/Myb domain
PfamPF002496.9E-151461IPR001005SANT/Myb domain
CDDcd001671.93E-101661No hitNo description
PROSITE profilePS5129422.9662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2465115IPR009057Homeodomain-like
SMARTSM007171.5E-1566114IPR001005SANT/Myb domain
PfamPF002491.3E-1467112IPR001005SANT/Myb domain
CDDcd001673.54E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0051555Biological Processflavonol biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0001081developmental stagemature plant embryo stage
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MGRAPCCEKV GLRRGRWTKE EDEKLARYIR ENGEGAWRSM PKNAGLLRCG KSCRLRWINY  60
LRADLKRGNI SPQEEDIILN LHATLGNRWS LIAGHLPGRT DNEIKNYWNS HLSRKGYEFL  120
RGGGGGAVVD VDLSKLPGGG KRRGGRTGRS SSGKEKTRTK EKDKAPAPEA AHNDDGGGGG  180
GGGIDNVSAA SHSHREEQAQ ASASGLTSDG LEEGPLGLSE EMVSGPVGPV SPKPEVGQDG  240
SSAESGCCGP SGSSGPTEAV GQDMGDKSMD WDLVGLDDGF ANDDMWGSLS WDYGELVGPD  300
GVHQGEVLSD LFFLGNL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-24121155107B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1567653140.0
Expression AtlasQ9FP39-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00627PBMTransfer from PK06182.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g19970.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g19970
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2886990.0AK288699.1 Oryza sativa Japonica Group cDNA, clone: J090061C22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628164.10.0PREDICTED: myb-related protein P
SwissprotP278987e-74MYBP_MAIZE; Myb-related protein P
TrEMBLQ9FP390.0Q9FP39_ORYSJ; Os01g0305900 protein
STRINGLOC_Os01g19970.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.12e-70myb domain protein 12