PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g19694.1
Common NameB1146F03.18, HOS16, LOC4325788, Os01g0302500, OSH6, P0035H10.13
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TALE
Protein Properties Length: 302aa    MW: 32735.8 Da    PI: 6.5194
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g19694.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-092352682255
                       SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
          Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                        +yp++e++ +LA+++gL+ +q+ +WF N+R ++
  LOC_Os01g19694.1 235 WPYPTEEDKLRLAARTGLDPKQINNWFINQRKRH 268
                       59*****************************885 PP

2ELK33.21.2e-11188209122
               ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                       ELK++Ll+KYsg+L+ L++EF+
  LOC_Os01g19694.1 188 ELKEMLLKKYSGCLSRLRSEFL 209
                       9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012558.1E-214185IPR005540KNOX1
PfamPF037903.6E-204383IPR005540KNOX1
SMARTSM012562.5E-2891142IPR005541KNOX2
PfamPF037911.5E-2494141IPR005541KNOX2
SMARTSM011883.6E-6188209IPR005539ELK domain
PfamPF037891.4E-8188209IPR005539ELK domain
PROSITE profilePS5121310.423188208IPR005539ELK domain
PROSITE profilePS5007112.843208271IPR001356Homeobox domain
SuperFamilySSF466894.28E-19210273IPR009057Homeodomain-like
SMARTSM003891.1E-13210275IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.5E-27213271IPR009057Homeodomain-like
CDDcd000861.46E-13220272No hitNo description
PfamPF059206.4E-17228267IPR008422Homeobox KN domain
PROSITE patternPS000270246269IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010073Biological Processmeristem maintenance
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MEDLYSIHPG ISRVGGAASE ASGVGVVVGG GGGSSSSDLT ELMKAQIAGH PRYPTLLSAY  60
IECRKVGAPP EVASLLKEIG RERRAGGGGG GAGQIGVDPE LDEFMEAYCR VLVRYKEELS  120
RPFDEAASFL SSIQTQLSNL CSGATSPPAT TATHSDEMVG SSDEDQCSGE TDMLDIGQEQ  180
SSRLADHELK EMLLKKYSGC LSRLRSEFLK KRKKGKLPKD ARSALLEWWN THYRWPYPTE  240
EDKLRLAART GLDPKQINNW FINQRKRHWK PSDGMRFALM EGVAGGSSGT TLYFDTGTIG  300
P*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1203212LRSEFLKKRK
2209213KKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.41630.0panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1160106770.0
Expression AtlasQ9FP29-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Highly expressed in the early globular stage embryo before 2 days after pollination (DAP), but not in the endosperm. At 3 and 4 DAP, expression is restricted to the region around or just below the center of the ventral side of the embryo, where the shoot apex subsequently arises. During the transition to the shoot apex differentiation stage, expression is divided between the upper and basal regions of the shoot area, and the notch between the first leaf primordium and epiblast, respectively. When the first leaf primordia is evident, expression is localized to the notches between the shoot apical meristem (SAM) and the first leaf primordium and the putative second leaf primordium. Expressed uniformly in the inflorescence meristem, but after the transition from inflorescence to the floral phase, located specifically in the notches between the floral meristem and glume primordia. At later stages of flower development, uniformly expressed throughout the corpus of the meristem, and in the notches between glume primordia, but less well defined than in the previous stage. {ECO:0000269|PubMed:10488233}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in shoot formation during early embryogenesis. {ECO:0000269|PubMed:10488233}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00670PBMTransfer from GRMZM2G087741Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g19694.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g19694
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0288830.0AB028883.1 Oryza sativa mRNA for knotted1-type homeobox protein OSH6, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634297.10.0PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP290.0KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLA0A0E0MV670.0A0A0E0MV67_ORYRU; Uncharacterized protein
STRINGLOC_Os01g19694.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16717148
MonocotsOGMP16983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.12e-78KNOTTED1-like homeobox gene 6
Publications ? help Back to Top
  1. Sentoku N, et al.
    Regional expression of the rice KN1-type homeobox gene family during embryo, shoot, and flower development.
    Plant Cell, 1999. 11(9): p. 1651-64
    [PMID:10488233]
  2. Jain M,Tyagi AK,Khurana JP
    Genome-wide identification, classification, evolutionary expansion and expression analyses of homeobox genes in rice.
    FEBS J., 2008. 275(11): p. 2845-61
    [PMID:18430022]