PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g19330.1
Common NameLOC4326726, Os01g0298400, OsJ_01424, OSJNBa0025P13.33, OSNPB_010298400, P0487H02.11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 294aa    MW: 32507 Da    PI: 5.9876
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g19330.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding482.9e-152370148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT eEd  l+ +v+  G g+W+  ar  g++Rt+k+c++rw++yl
  LOC_Os01g19330.1 23 RGPWTVEEDAVLAGYVAANGEGRWNELARAAGLRRTGKSCRLRWLNYL 70
                      89********************************************97 PP

2Myb_DNA-binding53.94.3e-1776119146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg +T++E++l+++++ ++G++ W++Ia++m+ gRt++++k++w++
  LOC_Os01g19330.1  76 RGDFTPQEQLLILELHFRWGNR-WSRIAQHMP-GRTDNEIKNYWRT 119
                       899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.1681870IPR017930Myb domain
SuperFamilySSF466899.73E-3021117IPR009057Homeodomain-like
SMARTSM007171.4E-112272IPR001005SANT/Myb domain
PfamPF002491.4E-132370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-212477IPR009057Homeodomain-like
CDDcd001673.00E-82570No hitNo description
PROSITE profilePS5129422.45371125IPR017930Myb domain
SMARTSM007176.5E-1575123IPR001005SANT/Myb domain
PfamPF002494.7E-1676119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2378124IPR009057Homeodomain-like
CDDcd001672.73E-1179119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000032anatomytetrad of microspores
PO:0001029developmental stageE tetrad stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MDAPCGWTTS AAAAVAEEED VRRGPWTVEE DAVLAGYVAA NGEGRWNELA RAAGLRRTGK  60
SCRLRWLNYL RPDVRRGDFT PQEQLLILEL HFRWGNRWSR IAQHMPGRTD NEIKNYWRTR  120
VQKHAKQLGC DVNSRQFKDV MRHLWMPRLV ERIHAAAASS ERAAPPPCAA APASHSGMCH  180
SPDPSTTTSS MAGSSVTHGE QFPSSTNHHL MTMASVTTAA ADWSSEQCGS GSATSTSVGI  240
SYDMFEGSWS ELLARAYDDD GADSSLLPDF QMADTGDNCW WSNLEDIWSQ QPY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-232011724120MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.679550.0callus| leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1160109800.0
Expression AtlasQ93V35-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g19330.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g19330
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0031400.0AP003140.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OSJNBa0025P13.
GenBankAP0028830.0AP002883.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0487H02.
GenBankAK2416150.0AK241615.1 Oryza sativa Japonica Group cDNA, clone: J065186D02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630818.10.0PREDICTED: transcription factor MYB108
TrEMBLQ93V350.0Q93V35_ORYSJ; Os01g0298400 protein
STRINGLOC_Os01g19330.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.12e-79myb domain protein 112