PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g18850.4
Common NameLOC4325162, Os01g0292900, OsJ_01398, P0706B05.40, SPL1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family SBP
Protein Properties Length: 863aa    MW: 95876.4 Da    PI: 6.9655
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g18850.4genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP118.53.4e-37106183178
                       --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
               SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       +Cqv+gC+++ls+a++y++rhkvCevh+k+ vv ++++e+rfCqqCsrfh l+efDe+k+sCr+rLa+hn+rrrk q 
  LOC_Os01g18850.4 106 CCQVDGCTVNLSSARDYNKRHKVCEVHTKSGVVRIKNVEHRFCQQCSRFHFLQEFDEGKKSCRSRLAQHNRRRRKVQV 183
                       6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.4E-28101168IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.248104181IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.44E-34105184IPR004333Transcription factor, SBP-box
PfamPF031101.4E-28107180IPR004333Transcription factor, SBP-box
SuperFamilySSF484034.02E-5594742IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.205.1E-4605741IPR020683Ankyrin repeat-containing domain
CDDcd002041.59E-4675740No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 863 aa     Download sequence    Send to blast
MSSGLKKKGL EWDLNDWRWD SNLFLATPSN ASPSKCSRRE LGRAEGEIDF GVVDKRRRVS  60
PEDDDGEECI NAATTNGDDG QISGQRGRSS EDEMPRQGTC SSSGPCCQVD GCTVNLSSAR  120
DYNKRHKVCE VHTKSGVVRI KNVEHRFCQQ CSRFHFLQEF DEGKKSCRSR LAQHNRRRRK  180
VQVQAGVDVN SLHENHSLSN TLLLLLKQLS GLDSSGPSEQ INGPNYLTNL VKNLAALAGT  240
QRNQDMLKNA NSAAIASHTG NYVAKGNSLH DSRPHIPVGT ESTAEEPTVE RRVQNFDLND  300
AYVEGDENRT DKIVFKLFGK EPNDFPSDLR AQILSWLSNC PSDIESYIRP GCIILTIYMR  360
LPNWMWDKLA ADPAHWIQKL ISLSTDTLWR TGWMYARVQD YLTLSCNGNL MLASPWQPAI  420
GNKHQILFIT PIAVACSSTA NFSVKGLNIA QPTTKLLCIF GGKYLIQEAT EKLLDDTKMQ  480
RGPQCLTFSC SFPSTSGRGF IEVEDLDQSS LSFPFVVAEE DVCSEIRTLE HLLNLVSFDD  540
TLVEKNDLLA SRDRALNFLH EFGWFLQRSH IRATSETPKD CTEGFPAARF RWLLSFAVDR  600
EFCAVIKKLL DTLFQGGVDL DVQSTVEFVL KQDLVFVAVN KRSKPLIDFL LTYTTSSAPM  660
DGTESAAPAQ FLFTPDIAGP SDITPLHIAA TYSDTAGVLD ALTDDPQQLG IKAWKNARDA  720
TGLTPEDYAR KRGHESYIEM VQNKIDSRLP KAHVSVTISS TTSTTDFTEK HASQSKTTDQ  780
TAFDVEKGQQ ISTKPPLSCR QCLPELAYRH HLNRFLSTRP AVLSLVAIAA VCVCVGLIMQ  840
GPPHIGGMRG PFRWNSLRSG PK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-2598180184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15458KRRRV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.207560.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329784890.0
Expression AtlasQ9LGU7-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g18850.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g18850
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0684710.0AK068471.1 Oryza sativa Japonica Group cDNA clone:J013155F18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015614292.10.0PREDICTED: squamosa promoter-binding-like protein 1 isoform X3
RefseqXP_015614297.10.0PREDICTED: squamosa promoter-binding-like protein 1 isoform X3
SwissprotQ9LGU70.0SPL1_ORYSJ; Squamosa promoter-binding-like protein 1
TrEMBLA0A0E0MV020.0A0A0E0MV02_ORYRU; Uncharacterized protein
STRINGLOC_Os01g18850.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Xie K,Wu C,Xiong L
    Genomic organization, differential expression, and interaction of SQUAMOSA promoter-binding-like transcription factors and microRNA156 in rice.
    Plant Physiol., 2006. 142(1): p. 280-93
    [PMID:16861571]
  2. Yang Z, et al.
    Comparative study of SBP-box gene family in Arabidopsis and rice.
    Gene, 2008. 407(1-2): p. 1-11
    [PMID:17629421]