PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g18240.1
Common NameLOC4327914, Os01g0285300, OsJ_01345, OSJNBa0004B13.27, OSNPB_010285300, P0498A12.22
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 429aa    MW: 47736.4 Da    PI: 6.6424
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g18240.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569.4e-181461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g W++eEde+l + ++++G g+W+t+++  g+ R++k+c++rw +yl
  LOC_Os01g18240.1 14 KGLWSPEEDEKLMNHITKHGHGCWSTVPKLAGLQRCGKSCRLRWINYL 61
                      678*******************************************97 PP

2Myb_DNA-binding48.12.7e-1567110146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg++++eE++l+v++++ lG++ W+ Ia +++ gRt++++k+ w++
  LOC_Os01g18240.1  67 RGAFSQEEEDLIVELHAVLGNR-WSQIATRLP-GRTDNEIKNLWNS 110
                       89********************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.396961IPR017930Myb domain
SuperFamilySSF466892.85E-2912108IPR009057Homeodomain-like
SMARTSM007176.5E-121363IPR001005SANT/Myb domain
PfamPF002495.5E-151461IPR001005SANT/Myb domain
CDDcd001671.06E-101761No hitNo description
PROSITE profilePS5129425.60162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.5E-2565116IPR009057Homeodomain-like
SMARTSM007176.5E-1366114IPR001005SANT/Myb domain
PfamPF002498.8E-1467110IPR001005SANT/Myb domain
CDDcd001671.65E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLMNHIT KHGHGCWSTV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQEEEDLIVE LHAVLGNRWS QIATRLPGRT DNEIKNLWNS CIKKKLRQKG  120
IDPNTHKPLA EVDRSKATPT ISNDRTSESS DVDPSSGVAL HNLSHLLSET AQSSELLPVK  180
VTKPRTQAPG LARLKVPPKE LFLDQLTSGH ENLPSCRSSG PIPNFPFQQL LCYNNDFNSM  240
DVGNRNSLWY NQNESSSSTI STVMPPVSPS TLSTSTGLNP SPDNANSRGT GIHNSQFYWD  300
TNNPSSSSST GSSGNNGLGF ELQSTSSLLE TNIFPWSDLA PEKDSQAQLE EELKWPDLLH  360
GTFSEMPAPM QNLSQSLYED VVKAESQFNM EGLCAAWSQN LLPQQHLPVV SDMYDKDLQR  420
MSLSFENI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28121165108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.17260.0flower| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2844317970.0
Expression AtlasQ9AQV2-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g18240.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g18240
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1118030.0AK111803.1 Oryza sativa Japonica Group cDNA clone:J013087D08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627109.10.0PREDICTED: transcription factor LAF1
TrEMBLA0A0E0FK980.0A0A0E0FK98_ORYNI; Uncharacterized protein
TrEMBLA0A0E0MUU70.0A0A0E0MUU7_ORYRU; Uncharacterized protein
TrEMBLA2WNL40.0A2WNL4_ORYSI; Putative uncharacterized protein
TrEMBLQ9AQV20.0Q9AQV2_ORYSJ; Os01g0285300 protein
STRINGLOC_Os01g18240.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA001872-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP23103794
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.13e-91myb domain protein 61