PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g17000.1
Common NameLOC4324267, Os01g0277500, P0038F12.32
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 491aa    MW: 52764.3 Da    PI: 7.0259
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g17000.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.41.5e-38110170262
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                       ++k+l+cprC+s++tkfCy+nny+++qPr+fC++C+ryWt+GGa+rnvPvG+grr+nk++s
  LOC_Os01g17000.1 110 PDKILPCPRCNSMETKFCYFNNYNVHQPRHFCRNCQRYWTAGGAMRNVPVGAGRRRNKHVS 170
                       7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-31107167IPR003851Zinc finger, Dof-type
PfamPF027012.4E-31112168IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.602114168IPR003851Zinc finger, Dof-type
PROSITE patternPS013610116152IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 491 aa     Download sequence    Send to blast
MAALRQGDDP AIKLFGRTIP LLLDPPAAAA AAADEVMPNL GNGVKTNNDL PLVSDKLLIV  60
KGIPFCPNNS KKNDLQGISR PDGRIEIDSM TEDVKTEPDG SVPEKILKKP DKILPCPRCN  120
SMETKFCYFN NYNVHQPRHF CRNCQRYWTA GGAMRNVPVG AGRRRNKHVS KYCQAMMTCN  180
NTVAPGDVSD VVHHQVITHG SSLLPATLKE NETPTEFISE VPPCKSSASI LDIGEPNDTD  240
LVPLASGDNK EEKSCASSVV VSSCSENLMP DNAIMKEPNN RSGCCNGVAL PFPTGPALVL  300
PWSLGWNSVA LMPATQCSMQ PVLGLKDGIP CPPSWPPQLM VPAPGICTPV VPIPLVPPLW  360
SCFPGWPNGM WNAQCPGGNT TVLPSTAPNK ISCSGSSSLV LGKHSREESL QEEEKTRNYL  420
WVPKTLRIDD PAEAAKSSIW ATLGIKPDDK GIFKSFQPNV AKNGTAPESP QALQANPAAF  480
SRSQSFQETT *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.888780.0callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329770020.0
Expression AtlasQ5NBP4-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g17000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g17000
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0669840.0AK066984.1 Oryza sativa Japonica Group cDNA clone:J013091E10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635234.10.0PREDICTED: cyclic dof factor 2
TrEMBLQ5NBP40.0Q5NBP4_ORYSJ; Ascorbate oxidase promoter-binding protein AOBP-like
STRINGLOC_Os01g17000.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.24e-62cycling DOF factor 2