PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g16810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 339aa    MW: 35716.6 Da    PI: 7.682
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g16810.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.4e-174994147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      rg W + Ed +l+d+v+q+G+ +W++Ia+++  gR++k+c++rw++ 
  LOC_Os01g16810.1 49 RGHWRPAEDAKLKDLVAQYGPQNWNLIAEKLD-GRSGKSCRLRWFNQ 94
                      899*****************************.***********996 PP

2Myb_DNA-binding57.53e-18101145147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       r ++T+eE+e+l  a++ +G++ W++Iar ++ gRt++ +k++w+ +
  LOC_Os01g16810.1 101 RRAFTEEEEERLMAAHRAYGNK-WALIARLFP-GRTDNAVKNHWHVL 145
                       678*******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.1264495IPR017930Myb domain
SMARTSM007174.7E-144897IPR001005SANT/Myb domain
SuperFamilySSF466894.12E-2849142IPR009057Homeodomain-like
PfamPF002497.2E-164994IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-2750102IPR009057Homeodomain-like
CDDcd001671.70E-135293No hitNo description
PROSITE profilePS5129427.2896150IPR017930Myb domain
SMARTSM007174.1E-15100148IPR001005SANT/Myb domain
PfamPF002493.8E-15101145IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-21103148IPR009057Homeodomain-like
CDDcd001675.28E-12103146No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MAHEMMGGFF GHPPPPPATA AVGEEEDEVV EETEEGGHGG GVQGKLCARG HWRPAEDAKL  60
KDLVAQYGPQ NWNLIAEKLD GRSGKSCRLR WFNQLDPRIN RRAFTEEEEE RLMAAHRAYG  120
NKWALIARLF PGRTDNAVKN HWHVLMARRH REQSGAFRRR KPSSSSASPA PAPAPPPPPQ  180
PVVALHHHHH RYSQQYSGYS GAAESDESAS TCTTDLSLSS GSAAAAAAAA AAANIPCCFY  240
QSTPRASSSS TAACRAPRVA AAADTVAFFP GAGYDFAAAP HAMAPAAAST FAPSARSAFS  300
APAGRGEPPG AVDQRGGAQA TTDSHTIPFF DFLGVGAT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-34491497107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.1007580.0panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329926700.0
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g16810.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g16810
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0008370.0AP000837.1 Oryza sativa Japonica Group genomic DNA, chromosome 1, clone:P0424A08.
GenBankAP0008360.0AP000836.1 Oryza sativa Japonica Group genomic DNA, chromosome 1, clone:P0038F12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631112.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0E0MUK30.0A0A0E0MUK3_ORYRU; Uncharacterized protein
STRINGLOC_Os01g16810.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.12e-71myb domain protein 105