PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g16660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family FAR1
Protein Properties Length: 753aa    MW: 85254.9 Da    PI: 6.2277
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g16660.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR125.73.8e-081331705290
              FAR1  52 rrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                       + +r+etr++C+a++k+++  dg + v+++  eH+H+la
  LOC_Os01g16660.1 133 SFSRPETRCKCQACMKISLI-DGLYSVYHFMPEHSHNLA 170
                       56899***************.****************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF105516.7E-28292386IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 753 aa     Download sequence    Send to blast
MADEFPIHVS VPSQLQNAGT TSILDDPSAP TFGDLDESKD PSDGILDDTS APTFRNLDES  60
KDPPDGLGRN QLEDDQGKNG TSDATKSMED KVPKVGMKFN SEQEAYDLYN AYAGEKGTRG  120
IDKRAEAAGY GDSFSRPETR CKCQACMKIS LIDGLYSVYH FMPEHSHNLA TKSQAHQLRS  180
QRKINEAQVA SVEVAKSVGI STKAAIDLMA KQACGFENLG FTRVDMKNKL YSKRSLQTKQ  240
GDTGGVLEYM EKKASEDVKF FYSIQVDEDD LITNIFWADS KMVSDYEDFC DVVCFDTTYR  300
KLDDGRPFGL LVGVNNHKKT TVFGATLLYD ETANSFVWLF NTFLNVMSGK KPKTIFTDED  360
AAMAKAIKIV FKGTHHRICV WHMNQNACKH LAGCVKDYKK FNADFQNCIY DQEEEEEFIH  420
AWNQLLDKYE LQQNTWLRRL FDKRHQWALV YGRNTFSADM STTQRNESLN NELKGYISVK  480
LVGDKRYEEV RCDFKATQST LKLKAELRIL RDVAEVYTPA VYKRFEEEVM QTLNCDIFYC  540
GDVDAEKVYK IKLQEVRIRR HPVLSCTEKY LTSTISNQSR NTCRAAKSEE TYSMSTNCAE  600
KLAEDIENFL KIRGDPDLDS SPSPQVAKEN QMASKPKGIK LKRKEIRGSA RPIGGLEKSS  660
QKRKKKKNED SPAEVLELQP VTEMQPQPYA TVLGNLEVPN DQAFLHVSRY YAALDASTSN  720
PTHVLMTPEN QGLHQQGRSI QQFDTDLYNL FN*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.895880.0callus| flower| leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g16660.1
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g16660
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0010810.0AP001081.1 Oryza sativa Japonica Group genomic DNA, chromosome 1, clone:P0693B08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002462721.10.0hypothetical protein SORBIDRAFT_02g030865, partial
TrEMBLQ69P280.0Q69P28_ORYSJ; Putative far-red impaired response protein
STRINGLOC_Os01g16660.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3012351
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.12e-85FAR1-related sequence 5