PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g15900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 552aa    MW: 59967.7 Da    PI: 4.7165
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g15900.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.29.7e-40164223261
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                       ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrk+k+s
  LOC_Os01g15900.1 164 PDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKSKSS 223
                       7899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-31161221IPR003851Zinc finger, Dof-type
PfamPF027013.3E-32166222IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.863168222IPR003851Zinc finger, Dof-type
PROSITE patternPS013610170206IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 552 aa     Download sequence    Send to blast
MCDKDPGIKL FGRVIPLAPE AEAAAAADGS DQPEAAAAAA AEVEPAAQDE DHHKETEERK  60
YDEMKVDVPQ EEEDNEMKVD APQEKKDNEV TADVPEEKGN DEMRVDASES IESIEPVSRS  120
TLDNKKEDQG QMNNVEEKAA SDSKDENEKT ANDESGQDKV LKKPDKILPC PRCNSMDTKF  180
CYYNNYNVNQ PRHFCKNCQR YWTAGGTMRN VPVGAGRRKS KSSSLHYRHL LMAPDCMMGS  240
RVEISKSMNP EAFASAHSTP IQPIGRNETV LKFGPEVPLC ESMASVLNIQ EQNGTNAAAV  300
PTGENQEDNS CISSITSHNV LPENAAQVDK NSTPVYCNGV GPVPQYYLGA PYMYPWNIGW  360
NNVPMMVPGT SMPESASQSE SCSTSSAPWM NMNSPMMPVA SRLSAPPFPY PLVPPALWGC  420
LSSWPATAWN IPWIRTNGGC MSPSSSSNSS CSGNGSPLGK HSRDSSLPLK EDKEEKSLWV  480
PKTLRIDDPD EAAKSSIWAT LGIKPGDPGI FKPFQSKGES KGQAASETRP ARALKANPAA  540
LSRSQSFQET S*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.117860.0callus| leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2977198160.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g15900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g15900
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0013830.0AP001383.1 Oryza sativa Japonica Group genomic DNA, chromosome 1, clone:P0453A06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618265.10.0PREDICTED: cyclic dof factor 2
TrEMBLB8AC630.0B8AC63_ORYSI; Putative uncharacterized protein
TrEMBLB9EV340.0B9EV34_ORYSJ; Uncharacterized protein
STRINGLOC_Os01g15900.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.26e-70cycling DOF factor 2