PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g14420.1
Common NameLOC4326758, Os01g0246500, OSNPB_010246500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Nin-like
Protein Properties Length: 316aa    MW: 33308.5 Da    PI: 8.3513
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g14420.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK72.26.9e-234995450
            RWP-RK  4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkik 50
                      ++s e++sk Fslpi++AA+ Lgvc++vLKriCR +GI RWP+Rk+ 
  LOC_Os01g14420.1 49 SLSYEEISKLFSLPIAEAASILGVCTSVLKRICRSHGIVRWPYRKLV 95
                      6899*****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.09732117IPR003035RWP-RK domain
PfamPF020425.2E-215095IPR003035RWP-RK domain
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0001081developmental stagemature plant embryo stage
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MCAAPMASTA QPQQQPQQQQ EQQPVAAAAV PTPAPPASEA QPQKPTRVSL SYEEISKLFS  60
LPIAEAASIL GVCTSVLKRI CRSHGIVRWP YRKLVSGKSG DDTKNAEREK AKGLLEISKV  120
AKQKALSASG LSTVSPGAFQ GVAKSQQGSS KAGQVSPPGK QNVLGGSAIL SYGTQTKGIP  180
TYMDDFKYGF PSSGLSLQTM KWWGTDSHTE TTPAKDDNGE APESANEASK GMTDDELDWG  240
ADEAEAEADA DSAITTEPSA QLCSLRRKAV DDGRKLLTGK SCGGLELCRL NKRQKMALAQ  300
VFGASLPEQL RSKLG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.17790.0callus| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329690020.0
Expression AtlasQ0JP39-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g14420.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g14420
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0589840.0AK058984.1 Oryza sativa Japonica Group cDNA clone:001-020-E04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625714.10.0PREDICTED: uncharacterized protein LOC4326758
TrEMBLI1NLU70.0I1NLU7_ORYGL; Uncharacterized protein
TrEMBLQ0JP390.0Q0JP39_ORYSJ; Os01g0246500 protein
STRINGLOC_Os01g14420.10.0(Oryza sativa Japonica Group)
STRINGORGLA01G0083700.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP866899
MonocotsOGMP67053242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74480.13e-10RWP-RK domain-containing protein