PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g13740.1
Common NameGLK2, LOC4326363, Os01g0239000, OSJNBa0086P08.28-1, OSJNBa0086P08.28-2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 540aa    MW: 56283.9 Da    PI: 6.5477
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g13740.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.61.2e-27215269156
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                       k +++WtpeLH+rFv+aveqL G++kA+P++ilelm++++Lt+++++SHLQkYR++
  LOC_Os01g13740.1 215 KVKVDWTPELHRRFVQAVEQL-GIDKAVPSRILELMGIECLTRHNIASHLQKYRSH 269
                       5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.104212271IPR017930Myb domain
SuperFamilySSF466896.09E-18213272IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-26213272IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-26215269IPR006447Myb domain, plants
PfamPF002492.4E-7218267IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MLEVSTLRSP KADQRAGVGG HHVVGFVPAP PSPADVADEV DAFIVDDSCL LEYIDFSCCD  60
VPFFHADDGD ILPDLEVDPT ELLAEFASSP DDEPPPTTSA PGPGEPAAAA GAKEDVKEDG  120
AAAAAAAAAA DYDGSPPPPR GKKKKDDEER SSSLPEEKDA KNGGGDEVLS AVTTEDSSAG  180
AAKSCSPSAE GHSKRKPSSS SSSAAAGKNS HGKRKVKVDW TPELHRRFVQ AVEQLGIDKA  240
VPSRILELMG IECLTRHNIA SHLQKYRSHR KHLMAREAEA ASWTQKRQMY TAAAAAAAVA  300
AGGGPRKDAA AATAAVAPWV MPTIGFPPPH AAAMVPPPPH PPPFCRPPLH VWGHPTAGVE  360
PTTAAAPPPP SPHAQPPLLP VWPRHLAPPP PPLPAAWAHG HQPAPVDPAA YWQQQYNAAR  420
KWGPQAVTPG TPCMPPPLPP AAMLQRFPVP PVPGMVPHPM YRPIPPPSPP QGNKLAALQL  480
QLDAHPSKES IDAAIGDVLV KPWLPLPLGL KPPSLDSVMS ELHKQGIPKV PPAASGAAG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-15212267257ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139145RGKKKKD
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.12290.0flower| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379906420.0
Expression AtlasQ5NAN5-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in leaves. {ECO:0000269|PubMed:11340194}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional activator that promotes chloroplast development. Acts as an activator of nuclear photosynthetic genes involved in chlorophyll biosynthesis, light harvesting, and electron transport (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g13740.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By light. {ECO:0000269|PubMed:11340194}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g13740
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1210190.0AK121019.1 Oryza sativa Japonica Group cDNA clone:J023049D13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615905.10.0PREDICTED: probable transcription factor GLK2 isoform X1
SwissprotQ5NAN50.0GLK2_ORYSJ; Probable transcription factor GLK2
TrEMBLA0A0E0MTQ30.0A0A0E0MTQ3_ORYRU; Uncharacterized protein
STRINGLOC_Os01g13740.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP28401529
MonocotsOGMP24153886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.12e-44GBF's pro-rich region-interacting factor 1
Publications ? help Back to Top
  1. Rossini L,Cribb L,Martin DJ,Langdale JA
    The maize golden2 gene defines a novel class of transcriptional regulators in plants.
    Plant Cell, 2001. 13(5): p. 1231-44
    [PMID:11340194]