PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g13540.1
Common NameLOC4327787, NLP3, Os01g0236700, OsJ_01032, P0708G02.34
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Nin-like
Protein Properties Length: 939aa    MW: 102439 Da    PI: 5.8783
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g13540.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.61.2e-28595646152
            RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       aek+isl++l++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  LOC_Os01g13540.1 595 AEKTISLDVLQQYFSGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 646
                       589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.541585666IPR003035RWP-RK domain
PfamPF020426.5E-26598646IPR003035RWP-RK domain
SuperFamilySSF542771.54E-19837929No hitNo description
SMARTSM006668.6E-24847926IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.3E-23847925No hitNo description
PfamPF005647.0E-14847925IPR000270PB1 domain
PROSITE profilePS5174517.643847926IPR000270PB1 domain
CDDcd064072.63E-31848925No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 939 aa     Download sequence    Send to blast
MEVDPSSSLP GAGEGGGGGI GGGGGDLWPF DSLTTSLLFS SVSASPQPLP ASSSSWLTPP  60
SPLWLFDERQ LLPLDMGAPA APATAPPAEA AAVVEEVHRT RSGNSDTTSK RVDQINSKWQ  120
FHLSIDDNTD SSCLFKERLT QALRYFKEST DQHLLVQVWA PVKSGDRYVL TTSGQPFVLD  180
QQSIGLLQYR AVSMMYMFSV DGENAGELGL PGRVYKQKVP EWTPNVQYYS STEYPRLNHA  240
ISYNVHGTVA LPVFDPSVQN CIAVVELIMT SKKINYAGEV DKVCKALEAV NLKSTEILDH  300
PNVQICNEGR QSALVEILEI LTVVCEEHKL PLAQTWVPCK YRSVLAHGGG VKKSCLSFDG  360
SCMGEVCMST SDVAFHVIDA HMWGFRDACV EHHLQKGQGV SGKAFIYRRP CFSKDISQFC  420
KLEYPLVHYA RMFGLAGCFA ICLQSMYTGD DDYILEFFLP PNCRNEDDQN ALLESILARM  480
KKCLRTLKVV GNGDTNEVCL QISNVLIIET EDLKTNVHFE NSEGCFRESP ESNGSQRVHE  540
VDNDGNKVSI MSERHLLADD NSQNNGASVG RPNGSGASDS LHKSNKPPER RRGKAEKTIS  600
LDVLQQYFSG SLKNAAKSLG VCPTTMKRIC RQHGISRWPS RKINKVNRSL SKLKQVIESV  660
QGSDAAFNLT SITGPLPIPV GPSSDSQNLE KASPNKVAEL SNLAVEGDRD SSLQKPIEND  720
NLAILMSQQG FIDANNNLQL EADKASHSRS SSGEGSINSR TSEASCHGSP ANQTFVCKPI  780
ASTFAEPQLI PEAFTKEPFQ EPALPLSRML IEDSGSSKDL KNLFTSAVDQ PFLARSSNLA  840
LMQNSGTVTI KASFKEDIVR FRFPCSGSVT ALKDEVAKRL RMDVGMFDIK YLDDDHEWVK  900
LACNADLEEC MEISGSHVIR LLVSDVAAHL GSSCGSSG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.38380.0callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154355430.0
Expression AtlasQ5NB82-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g13540.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g13540
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0673190.0AK067319.1 Oryza sativa Japonica Group cDNA clone:J013106K21, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613020.10.0PREDICTED: protein NLP3
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLA0A0E0MTN60.0A0A0E0MTN6_ORYRU; Uncharacterized protein
STRINGLOC_Os01g13540.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2991697
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein
Publications ? help Back to Top
  1. Schauser L,Wieloch W,Stougaard J
    Evolution of NIN-like proteins in Arabidopsis, rice, and Lotus japonicus.
    J. Mol. Evol., 2005. 60(2): p. 229-37
    [PMID:15785851]