PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g12860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 973aa    MW: 106569 Da    PI: 4.8312
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g12860.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.94e-1239761048
                      HHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding 10 ellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +l +av+ + g++Wk+Ia++++  Rt+ qc +rwqk+l
  LOC_Os01g12860.1 39 AILSRAVQTYNGKNWKKIAECFP-DRTDVQCLHRWQKVL 76
                      57899******************.************986 PP

2Myb_DNA-binding62.49.4e-2082128148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g+W++eEde++v+ v++lG++ W+tIa+ ++ gR +kqc++rw+++l
  LOC_Os01g12860.1  82 KGPWSKEEDEIIVQMVNKLGPKKWSTIAQALP-GRIGKQCRERWYNHL 128
                       79******************************.*************97 PP

3Myb_DNA-binding48.51.9e-15134176145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       + +WT+eE+  l++a++++G++ W+   + ++ gRt++++k++w+
  LOC_Os01g12860.1 134 KEAWTQEEEITLIHAHRMYGNK-WAELTKFLP-GRTDNSIKNHWN 176
                       579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001671.51E-93876No hitNo description
Gene3DG3DSA:1.10.10.601.2E-193893IPR009057Homeodomain-like
PROSITE profilePS500907.5613876IPR017877Myb-like domain
SMARTSM007175.5E-53878IPR001005SANT/Myb domain
SuperFamilySSF466894.88E-113886IPR009057Homeodomain-like
PfamPF002499.8E-103976IPR001005SANT/Myb domain
PROSITE profilePS5129431.18377132IPR017930Myb domain
SuperFamilySSF466898.99E-3179175IPR009057Homeodomain-like
SMARTSM007173.2E-1881130IPR001005SANT/Myb domain
PfamPF002491.2E-1782128IPR001005SANT/Myb domain
CDDcd001675.84E-1684128No hitNo description
Gene3DG3DSA:1.10.10.601.7E-2594135IPR009057Homeodomain-like
PROSITE profilePS5129419.815133183IPR017930Myb domain
SMARTSM007172.2E-14133181IPR001005SANT/Myb domain
PfamPF002496.3E-14134177IPR001005SANT/Myb domain
CDDcd001674.03E-11136176No hitNo description
Gene3DG3DSA:1.10.10.601.1E-21136183IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 973 aa     Download sequence    Send to blast
MESLLDLRRL LKKEKSAMNQ KGDDLSMGKR LKALLTIDAI LSRAVQTYNG KNWKKIAECF  60
PDRTDVQCLH RWQKVLNPEL VKGPWSKEED EIIVQMVNKL GPKKWSTIAQ ALPGRIGKQC  120
RERWYNHLNP GINKEAWTQE EEITLIHAHR MYGNKWAELT KFLPGRTDNS IKNHWNSSVK  180
KKVNSYMSSG LLTQVSCLPL NEYSANCNSS PAMTQQNSED SGCFAVREVE NSSGCSQSSL  240
AKVSCSQVHD TTVPLGCDLQ VNANFDKNEA HDSQSSMGPQ ACYTSAEAVA SALPAVHCHV  300
SSSNLDPDQH LQEDFAQGLN LDMTIDEMPT VPSFADNQTV CSIENHERSL EPYDVAMEVP  360
LSMLSSDSGA EQKLHFMSEA DFNSPNCLKS ELWQDISLQG LLSGPDAVEA DSISRSNHQS  420
DVYSSEADTH FLAPPYMPQT SNSSSVMGLA DDQSPQMSVP PSLICSNAMT DDAPFDNRPG  480
RKEMPLSQAE VVTQSSSSSG DAEMFANPGC SNDRHVPSST MESIPECGDQ QVTNAEEPEA  540
SLEKEPSLTQ SVTAPDEQDK GALFYEPPRF PSLDVPFVSC DLVTSGDLQE FSPLGIRQLM  600
HSTMNVCTPM RLWGSPTHDE STGVLLKSAA KSFICTPSIL KKRHRDLLSP IPDKRIEKKY  660
GTEKDRGVSD TSSTGIQTSC INATKDDALI TTVLRIERSA SSKSLEKKLV FSDENKENLG  720
YTTEQTKDGQ SAGNDEHMDE QTTGERSSAT NVATNDDLSG NLQPAGILIE HSGDDPISPD  780
YGKNTMNQKL NTNVKSLSVC KEGVCAKSKP TELIVEKSSP CINVDYEYVN ILADTPGIKR  840
GLESPSAWKS PWFVDMHFQG SYFTSPADSY DALGLMKQIN VQTAAALVEA REVLASGGQC  900
DNISSDKENT GNPDAKKEPG TTKLQTKIMA EGRVLDFECT TPERSSDKNA GSNLGRYLSS  960
PIPSSHLLKS FR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-623818314159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-623818314159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.223730.0callus| flower| panicle| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g12860.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g12860
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3186010.0AK318601.1 Oryza sativa Japonica Group cDNA, clone: J100066E24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625869.10.0PREDICTED: myb-related protein 3R-1 isoform X1
TrEMBLI1NLJ20.0I1NLJ2_ORYGL; Uncharacterized protein
STRINGLOC_Os01g12860.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.11e-122myb domain protein 3r-4